Plant FIBer expression Database

Potri.008G026250 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.008G026250.1 pacid=42808374 polypeptide=Potri.008G026250.1.p locus=Potri.008G026250 ID=Potri.008G026250.1.v4.1 annot-version=v4.1
ATGCACGCTGATGCCTTCAGAACTTTGCCTTTGGTGTGGTGGTGGCCACGGTCAGTCTGTTCGGTTTTCTCCGCTGGAATCTCTCTCCTCGGCACTATAT
TAACGTTCTTAGGTTGCCAGAAAATAATATCGAGGAGCTTGGCCGGAATGATTTCTACAAAACTGGAAGTTTTGAATGCTCAGACAATATTGAAGTCAGG
TATTTTCAGCTTATTTCTACTTTGTACACTTTTGGGGTTTATGTTCATCGGAAAGATAGCATCAAAAAATTTCATGGAAGAGATTGAGAGTGAAAATAGC
CAATTTTTCCATACATACAAAATGGATGTCACCTCACTATTCATCCTCGGCCTCCTGGCAGTGTCAAGCAGAGTCCCTGGTTCATAA
AA sequence
>Potri.008G026250.1 pacid=42808374 polypeptide=Potri.008G026250.1.p locus=Potri.008G026250 ID=Potri.008G026250.1.v4.1 annot-version=v4.1
MHADAFRTLPLVWWWPRSVCSVFSAGISLLGTILTFLGCQKIISRSLAGMISTKLEVLNAQTILKSGIFSLFLLCTLLGFMFIGKIASKNFMEEIESENS
QFFHTYKMDVTSLFILGLLAVSSRVPGS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.008G026250
[exp]
0 1
AT3G61350 SKIP4 SKP1 interacting partner 4 (.1... Potri.014G083200
[exp]
13.49 0.6174 Pt-SKIP4.1
AT1G02660 alpha/beta-Hydrolases superfam... Potri.002G197900
[exp]
14.96 0.7620
AT3G57810 Cysteine proteinases superfami... Potri.008G026100
[exp]
20.09 0.7616
AT1G54100 ALDH7B4 aldehyde dehydrogenase 7B4 (.1... Potri.001G167100
[exp]
38.34 0.7370 ALDH7.1
AT3G11930 Adenine nucleotide alpha hydro... Potri.016G064000
[exp]
39.11 0.7063
AT1G72510 Protein of unknown function (D... Potri.006G219100
[exp]
45.59 0.7164
AT5G61580 PFK4 phosphofructokinase 4 (.1.2) Potri.003G151100
[exp]
61.79 0.6429
AT1G75800 Pathogenesis-related thaumatin... Potri.002G020500
[exp]
92.96 0.6617
AT1G21695 hydroxyproline-rich glycoprote... Potri.005G181200
[exp]
115.02 0.6177
AT4G21440 MYB ATMYB102, ATM4 A. THALIANA MYB 4, MYB-like 10... Potri.011G041600
[exp]
124.06 0.6475

Potri.008G026250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.