Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52790 114 / 2e-34 peptidoglycan-binding LysM domain-containing protein (.1) AT5G62150 98 / 4e-28 peptidoglycan-binding LysM domain-containing protein (.1) AT4G25433 91 / 3e-25 peptidoglycan-binding LysM domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G231000 [exp] 174 / 6e-58 AT3G52790 119 / 3e-36 peptidoglycan-binding LysM domain-containing protein (.1) Potri.014G077900 [exp] 120 / 1e-36 AT4G25433 108 / 7e-32 peptidoglycan-binding LysM domain-containing protein (.1) Potri.015G137500 [exp] 115 / 6e-35 AT4G25433 113 / 7e-34 peptidoglycan-binding LysM domain-containing protein (.1) Potri.012G135100 [exp] 101 / 3e-29 AT4G25433 108 / 5e-32 peptidoglycan-binding LysM domain-containing protein (.1) Potri.002G152600 [exp] 101 / 4e-29 AT5G62150 100 / 1e-28 peptidoglycan-binding LysM domain-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031662 [exp] 124 / 4e-38 AT3G52790 112 / 4e-33 peptidoglycan-binding LysM domain-containing protein (.1) Lus10027407 [exp] 120 / 2e-36 AT3G52790 115 / 2e-34 peptidoglycan-binding LysM domain-containing protein (.1) Lus10015011 [exp] 97 / 1e-27 AT5G62150 107 / 5e-32 peptidoglycan-binding LysM domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0187 [poplar] [flax] LysM PF01476 [poplar] [flax] LysM LysM domain
Representative CDS sequence Show only first row Show all	>Potri.008G030200.1 pacid=42806416 polypeptide=Potri.008G030200.1.p locus=Potri.008G030200 ID=Potri.008G030200.1.v4.1 annot-version=v4.1 ATGGGTTCTGTTTCTTCATCAACTGTGATGGCAGAAAAGATTTCTTGGTATTGTGCTTTGTTGATGGCGCTAATGCTGGTTTTGAGCTGCTGTGAAGTGA GTGAAAGTGAATTGGCTGCTGTTGGGCATCCGAGGGTTTTTGAGGACAAGCCATGCGATGAGATATATGTGGTCCGAGAAGGTGAGACTTTGCATACTAT TAGTGAAAAATGTCGGGATCCTTATATTGTTGAAGAAAATCCACACATTCATGACCCAGATGATGTTTTCCCTGGCCTGGTCATCAAGATTACCCCTTTC AACGATAGGTAA
AA sequence Show only first row Show all	>Potri.008G030200.1 pacid=42806416 polypeptide=Potri.008G030200.1.p locus=Potri.008G030200 ID=Potri.008G030200.1.v4.1 annot-version=v4.1 MGSVSSSTVMAEKISWYCALLMALMLVLSCCEVSESELAAVGHPRVFEDKPCDEIYVVREGETLHTISEKCRDPYIVEENPHIHDPDDVFPGLVIKITPF NDR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G52790			peptidoglycan-binding LysM dom...		Potri.008G030200 [exp]	0	1
AT3G15050		IQD10	IQ-domain 10 (.1)		Potri.001G375700 [exp]	1.00	0.9531
AT4G24990		ATGP4	Ubiquitin family protein (.1)		Potri.012G103100 [exp]	1.73	0.9168
AT5G47635			Pollen Ole e 1 allergen and ex...		Potri.006G005600 [exp]	2.44	0.9382
AT4G00755			F-box family protein (.1.2)		Potri.014G076300 [exp]	4.24	0.8924
AT3G23090			TPX2 (targeting protein for Xk...		Potri.008G162800 [exp]	5.00	0.9099
AT2G47500			P-loop nucleoside triphosphate...		Potri.005G021100 [exp]	5.29	0.9109
AT4G01710		ARPC5, CRK	CROOKED, ARP2/3 complex 16 kDa...		Potri.014G045200 [exp]	5.47	0.8827	Pt-CRK.1
AT5G43150			unknown protein		Potri.008G152200 [exp]	5.47	0.9042
AT5G01430			Got1/Sft2-like vescicle transp...		Potri.007G124400 [exp]	5.65	0.8823
AT5G16490		RIC4	ROP-interactive CRIB motif-con...		Potri.019G053300 [exp]	7.14	0.8807

Compare expression of checked genes

Potri.008G030200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.