Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59910 190 / 4e-63 HTB4 Histone superfamily protein (.1) AT2G28720 188 / 2e-62 Histone superfamily protein (.1) AT1G07790 185 / 2e-61 HTB1 Histone superfamily protein (.1) AT5G02570 185 / 2e-61 Histone superfamily protein (.1) AT3G45980 184 / 5e-61 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1) AT3G46030 184 / 1e-60 HTB11 Histone superfamily protein (.1) AT5G22880 183 / 1e-60 HTB2, H2B HISTONE H2B, histone B2 (.1) AT3G53650 182 / 2e-60 Histone superfamily protein (.1) AT2G37470 181 / 1e-59 Histone superfamily protein (.1) AT3G09480 166 / 3e-54 Histone superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G230701 [exp] 196 / 2e-65 AT5G59910 191 / 3e-63 Histone superfamily protein (.1) Potri.008G030400 [exp] 192 / 3e-64 AT5G59910 191 / 2e-63 Histone superfamily protein (.1) Potri.010G230801 [exp] 191 / 2e-63 AT1G07790 205 / 2e-69 Histone superfamily protein (.1) Potri.010G230600 [exp] 191 / 2e-63 AT1G07790 205 / 3e-69 Histone superfamily protein (.1) Potri.010G231300 [exp] 189 / 4e-63 AT1G07790 177 / 3e-58 Histone superfamily protein (.1) Potri.008G030600 [exp] 189 / 8e-63 AT5G59910 188 / 2e-62 Histone superfamily protein (.1) Potri.009G028001 [exp] 188 / 2e-62 AT5G02570 188 / 2e-62 Histone superfamily protein (.1) Potri.017G123700 [exp] 188 / 2e-62 AT5G02570 188 / 2e-62 Histone superfamily protein (.1) Potri.004G091200 [exp] 187 / 3e-62 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017456 [exp] 191 / 8e-64 AT2G28720 226 / 1e-77 Histone superfamily protein (.1) Lus10040855 [exp] 191 / 2e-63 AT3G45980 247 / 2e-85 HISTONE H2B, Histone superfamily protein (.1) Lus10005897 [exp] 189 / 1e-62 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1) Lus10005893 [exp] 189 / 1e-62 AT3G45980 234 / 8e-81 HISTONE H2B, Histone superfamily protein (.1) Lus10023753 [exp] 188 / 1e-62 AT2G37470 203 / 7e-69 Histone superfamily protein (.1) Lus10016156 [exp] 187 / 7e-62 AT3G45980 231 / 1e-79 HISTONE H2B, Histone superfamily protein (.1) Lus10037371 [exp] 184 / 7e-61 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1) Lus10041347 [exp] 184 / 1e-60 AT3G45980 226 / 3e-77 HISTONE H2B, Histone superfamily protein (.1) Lus10013544 [exp] 183 / 2e-60 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1) Lus10017292 [exp] 182 / 3e-60 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [poplar] [flax] Histone PF00125 [poplar] [flax] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Potri.008G030500.1 pacid=42806240 polypeptide=Potri.008G030501.1.p locus=Potri.008G030500 ID=Potri.008G030500.1.v4.1 annot-version=v4.1 ATGGCTCCCAAGGCAGAAAAGAAGCCAGCCGAGAAAAAGCCAGCCGAGAAAAAGCCAGCCGCAGCCGAGAAAGCGCCGGCGGAGAAGCCAAGGGCAGAGA AGAAATTGCCTAAAGAAGGAGCGATTGACAAGAAGAGGAAGAAGGCTAAGAAGAGCGTGGAGACCTACAAGATTTACATCTTCAAGGTTTTGAAACAAGT CCATCCTGATATTGGGATCTCAAGCAAAGCAATGGGTATCATGAATAGTTTCATCAATGATATCTTTGAAAAGCTTGCTCAAGAAGCTTCGAGGCTCGCT CGGTATAACAAGAAGCCTACCATTACGTCCCGGGAGATCCAGACTGCTGTTAGACTGGTTTTGCCTGGAGAGCTTGCGAAACATGCCGTTTCTGAAGGGA CTAAGGCTGTTACCAAGTTTACCAGCTCTTAG
AA sequence Show only first row Show all	>Potri.008G030500.1 pacid=42806240 polypeptide=Potri.008G030501.1.p locus=Potri.008G030500 ID=Potri.008G030500.1.v4.1 annot-version=v4.1 MAPKAEKKPAEKKPAEKKPAAAEKAPAEKPRAEKKLPKEGAIDKKRKKAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLA RYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G59910		HTB4	Histone superfamily protein (....		Potri.008G030500 [exp]	0	1
AT1G49140			Complex I subunit NDUFS6 (.1)		Potri.012G056900 [exp]	3.74	0.9328
AT1G27530			unknown protein		Potri.002G107600 [exp]	5.47	0.8913
AT2G23940			Protein of unknown function (D...		Potri.018G101100 [exp]	7.07	0.8961
AT3G52300		ATPQ	"ATP synthase D chain, mitocho...		Potri.010G217800 [exp]	10.39	0.9101
AT1G02130		ARA5, AtRABD2a,...	ARABIDOPSIS THALIANA RAB D2A, ...		Potri.014G049400 [exp]	14.83	0.9059	RAB1.2
AT2G20820			unknown protein		Potri.019G109100 [exp]	15.87	0.8939
AT5G50850		MAB1	MACCI-BOU, Transketolase famil...		Potri.001G061400 [exp]	16.52	0.8940
AT3G12260			LYR family of Fe/S cluster bio...		Potri.001G029900 [exp]	17.74	0.8840
AT2G21870		MGP1	MALE GAMETOPHYTE DEFECTIVE 1, ...		Potri.005G085500 [exp]	18.00	0.9016
AT1G32210		ATDAD1	DEFENDER AGAINST APOPTOTIC DEA...		Potri.003G096800 [exp]	18.73	0.8992	Pt-DAD1.1

Compare expression of checked genes

Potri.008G030500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.