Potri.008G030901 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04420 122 / 5e-33 Galactose oxidase/kelch repeat superfamily protein (.1.2.3)
AT3G05420 68 / 6e-14 ACBP4 acyl-CoA binding protein 4 (.1.2)
AT5G27630 65 / 8e-13 ACBP5 acyl-CoA binding protein 5 (.1)
AT5G18590 40 / 0.0004 Galactose oxidase/kelch repeat superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G031200 200 / 1e-62 AT5G04420 655 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1.2.3)
Potri.010G230300 182 / 8e-56 AT5G04420 657 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1.2.3)
Potri.013G018800 66 / 5e-13 AT3G05420 999 / 0.0 acyl-CoA binding protein 4 (.1.2)
Potri.005G026900 62 / 8e-12 AT3G05420 1005 / 0.0 acyl-CoA binding protein 4 (.1.2)
Potri.008G214900 40 / 0.0004 AT5G18590 819 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037933 150 / 2e-43 AT5G04420 648 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1.2.3)
Lus10038666 149 / 4e-43 AT5G04420 655 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1.2.3)
Lus10017457 131 / 1e-36 AT5G04420 610 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1.2.3)
Lus10028825 125 / 3e-34 AT5G04420 622 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1.2.3)
Lus10029902 68 / 8e-14 AT3G05420 1040 / 0.0 acyl-CoA binding protein 4 (.1.2)
Lus10004499 68 / 9e-14 AT3G05420 1019 / 0.0 acyl-CoA binding protein 4 (.1.2)
Lus10031497 52 / 3e-08 AT3G05420 1027 / 0.0 acyl-CoA binding protein 4 (.1.2)
Lus10015176 51 / 6e-08 AT3G05420 1024 / 0.0 acyl-CoA binding protein 4 (.1.2)
Lus10043420 42 / 8e-05 AT5G18590 611 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1.2)
Lus10034163 40 / 0.0003 AT5G18590 785 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.008G030901.1 pacid=42808465 polypeptide=Potri.008G030901.1.p locus=Potri.008G030901 ID=Potri.008G030901.1.v4.1 annot-version=v4.1
ATGAGACTTAAACCAAGAGATGCATCGCGTCCAAAGATTTTTCGGTCAGCAGCTTCTGTTACTGCTGCACATGCCTTGGCCAAATCTGAAAAGTTGGATT
TCTCCAACTTAAATCTGAACTCTAATGGAACTGGAAAGAATTCTACTGAACAAGATTTGGGATTTGAAATTGATGCACTGAAAGAAGAGAAAAAGGTGCT
GGAATTGCCCCTCGCAGAAGTCAGAGCAGACAATTTTAGGCTTACAGAAAAGATTGATGAAGTTAATGGTACTCATGCAGAACTCTCCAAGGAACTTCAT
TCTGTCCAAGGTCAACTAGTTGCTGAAAGATCAAGATGCTTTAAACTTGAGGCACAAACTGCCGAGTTACAGATGATGCTGGAATCATTGCAGTCCATAG
AGAATGAAGTACAGCTACTTAGAAGACAGAAGTCTGCATCGGATCTGTTGGTGTCTGGCGTTGGATAG
AA sequence
>Potri.008G030901.1 pacid=42808465 polypeptide=Potri.008G030901.1.p locus=Potri.008G030901 ID=Potri.008G030901.1.v4.1 annot-version=v4.1
MRLKPRDASRPKIFRSAASVTAAHALAKSEKLDFSNLNLNSNGTGKNSTEQDLGFEIDALKEEKKVLELPLAEVRADNFRLTEKIDEVNGTHAELSKELH
SVQGQLVAERSRCFKLEAQTAELQMMLESLQSIENEVQLLRRQKSASDLLVSGVG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G04420 Galactose oxidase/kelch repeat... Potri.008G030901 0 1
AT1G67420 Zn-dependent exopeptidases sup... Potri.008G175400 6.00 0.9158
AT1G20760 Calcium-binding EF hand family... Potri.002G008300 6.32 0.9265
Potri.006G062150 8.48 0.9307
AT3G13845 unknown protein Potri.001G196150 10.95 0.9157
AT3G53540 unknown protein Potri.006G213700 11.57 0.8830
AT4G16450 unknown protein Potri.016G009600 13.85 0.9220
AT5G47540 Mo25 family protein (.1) Potri.019G057100 14.24 0.9100
AT5G62740 AtHIR4, ATHIR1 hypersensitive induced reactio... Potri.015G065001 14.45 0.9157
AT2G37980 O-fucosyltransferase family pr... Potri.006G095300 14.49 0.9152
Potri.019G038142 15.87 0.8863

Potri.008G030901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.