Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04260 216 / 1e-71 WCRKC2 WCRKC thioredoxin 2 (.1) AT5G06690 157 / 2e-48 WCRKC1 WCRKC thioredoxin 1 (.1.2) AT3G15360 52 / 3e-08 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) AT1G03680 50 / 9e-08 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1) AT2G35010 50 / 2e-07 ATO1 thioredoxin O1 (.1.2) AT4G03520 45 / 7e-06 ATHM2 Thioredoxin superfamily protein (.1.2) AT5G39950 44 / 7e-06 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G19730 43 / 1e-05 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT3G17880 44 / 4e-05 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT1G52990 42 / 0.0001 thioredoxin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G225701 [exp] 316 / 2e-111 AT5G04260 204 / 3e-67 WCRKC thioredoxin 2 (.1) Potri.016G059500 [exp] 155 / 4e-48 AT5G06690 212 / 4e-70 WCRKC thioredoxin 1 (.1.2) Potri.005G186800 [exp] 54 / 7e-09 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2) Potri.001G401500 [exp] 53 / 1e-08 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.002G073000 [exp] 51 / 6e-08 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2) Potri.013G132200 [exp] 48 / 8e-07 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2) Potri.019G111200 [exp] 47 / 1e-06 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2) Potri.017G076700 [exp] 47 / 1e-06 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Potri.005G058400 [exp] 47 / 2e-06 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038703 [exp] 194 / 1e-62 AT5G04260 191 / 2e-61 WCRKC thioredoxin 2 (.1) Lus10037975 [exp] 148 / 3e-46 AT5G04260 149 / 3e-47 WCRKC thioredoxin 2 (.1) Lus10021067 [exp] 149 / 2e-45 AT5G06690 215 / 3e-71 WCRKC thioredoxin 1 (.1.2) Lus10017244 [exp] 103 / 8e-28 AT5G06690 156 / 2e-48 WCRKC thioredoxin 1 (.1.2) Lus10005258 [exp] 47 / 5e-07 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10042784 [exp] 48 / 6e-07 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029752 [exp] 48 / 6e-07 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029755 [exp] 48 / 7e-07 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10040887 [exp] 47 / 2e-06 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10014798 [exp] 47 / 2e-06 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00085 [poplar] [flax] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Potri.008G036400.2 pacid=42806932 polypeptide=Potri.008G036400.2.p locus=Potri.008G036400 ID=Potri.008G036400.2.v4.1 annot-version=v4.1 ATGTCTAAGATCTTACACAGCCCACCATCTCTCAGATTTCTGTCTCCAAACTCAATACCACGTGACCCATCACGTGACTTGTCAGTATTAAGTAGTACTA TTTCATGTCCAAATCCCGCAATTTCGATTTTCAAGAAACTTTCTTCTCCCGGAAAATTTAATTTGCCAGGGAAAAATAGAGACTTTCGTGCTTGGAGCCA AGAGGGGCCTTTGCAAGAGGTGGATGATTCTCCTGTTTCGTTTGAGTTGGAGCCCATTTACAGTGAGAGTCAGTTTGATCGTGTGATTGCAGAGGCACAG CAACTAGAGGAATCTGTTATCATTGTTTGGATGGCAAGCTGGTGCAGAAAATGTATATATTTGAAACCAAAATTGGAAAAGTTGGCAGCTGATTACTATA GAAGATCGCGGTTTTACCGTGTCGATGTCAATAATGTTCCACACAAACTTGTTACTCGTGCAGGAGTCACTAAAATGCCAACCATTCAGCTATGGAAGGA TAGCAAGAAACAGGCAGAGGTGATTGGTGGTCACAAAGCATATTTGGTCATTAATGAAGTTCGTGAAATGATTGAAAATGAGGATACCTTGTGA
AA sequence Show only first row Show all	>Potri.008G036400.2 pacid=42806932 polypeptide=Potri.008G036400.2.p locus=Potri.008G036400 ID=Potri.008G036400.2.v4.1 annot-version=v4.1 MSKILHSPPSLRFLSPNSIPRDPSRDLSVLSSTISCPNPAISIFKKLSSPGKFNLPGKNRDFRAWSQEGPLQEVDDSPVSFELEPIYSESQFDRVIAEAQ QLEESVIIVWMASWCRKCIYLKPKLEKLAADYYRRSRFYRVDVNNVPHKLVTRAGVTKMPTIQLWKDSKKQAEVIGGHKAYLVINEVREMIENEDTL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G04260		WCRKC2	WCRKC thioredoxin 2 (.1)		Potri.008G036400 [exp]	0	1
AT3G52105			unknown protein		Potri.006G054200 [exp]	16.58	0.8649
AT1G18140		LAC1, ATLAC1	laccase 1 (.1)		Potri.015G040600 [exp]	18.27	0.8631
AT4G15350		CYP705A2	"cytochrome P450, family 705, ...		Potri.009G066200 [exp]	26.26	0.8608
AT2G15960			unknown protein		Potri.004G148200 [exp]	26.32	0.8499
AT3G20140		CYP705A23	"cytochrome P450, family 705, ...		Potri.009G066300 [exp]	28.77	0.8546
AT3G16510			Calcium-dependent lipid-bindin...		Potri.001G070400 [exp]	30.39	0.8507
AT1G72680		ATCAD1	CINNAMYL ALCOHOL DEHYDROGENASE...		Potri.011G148200 [exp]	32.32	0.8367
AT2G29120		ATGLR2.7	GLUTAMATE RECEPTOR 2.7, gluta...		Potri.011G062600 [exp]	38.14	0.8509
AT1G72680		ATCAD1	CINNAMYL ALCOHOL DEHYDROGENASE...		Potri.011G148100 [exp]	40.80	0.8145
					Potri.015G140800 [exp]	41.83	0.8392

Compare expression of checked genes

Potri.008G036400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.