Potri.008G036700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04250 373 / 1e-128 Cysteine proteinases superfamily protein (.1.2)
AT5G03330 246 / 7e-79 Cysteine proteinases superfamily protein (.1.2)
AT3G02070 228 / 2e-73 Cysteine proteinases superfamily protein (.1)
AT3G22260 195 / 2e-60 Cysteine proteinases superfamily protein (.1.2.3)
AT2G39320 94 / 2e-22 Cysteine proteinases superfamily protein (.1)
AT2G27350 56 / 3e-08 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
AT5G67170 54 / 9e-08 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G225400 513 / 0 AT5G04250 360 / 2e-123 Cysteine proteinases superfamily protein (.1.2)
Potri.006G125900 304 / 2e-101 AT5G03330 329 / 1e-111 Cysteine proteinases superfamily protein (.1.2)
Potri.016G094700 297 / 5e-99 AT5G03330 316 / 9e-107 Cysteine proteinases superfamily protein (.1.2)
Potri.008G036900 277 / 3e-93 AT5G04250 239 / 4e-79 Cysteine proteinases superfamily protein (.1.2)
Potri.014G140200 222 / 4e-71 AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1)
Potri.016G019700 219 / 4e-70 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3)
Potri.006G021700 215 / 2e-68 AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3)
Potri.005G140500 62 / 3e-10 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Potri.009G160100 52 / 3e-07 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038708 401 / 3e-139 AT5G04250 367 / 2e-126 Cysteine proteinases superfamily protein (.1.2)
Lus10037977 397 / 1e-137 AT5G04250 361 / 5e-124 Cysteine proteinases superfamily protein (.1.2)
Lus10037388 267 / 2e-87 AT5G04250 239 / 6e-77 Cysteine proteinases superfamily protein (.1.2)
Lus10001404 264 / 8e-86 AT5G03330 327 / 9e-111 Cysteine proteinases superfamily protein (.1.2)
Lus10013813 261 / 1e-84 AT5G03330 280 / 2e-92 Cysteine proteinases superfamily protein (.1.2)
Lus10023019 261 / 1e-84 AT5G03330 325 / 4e-110 Cysteine proteinases superfamily protein (.1.2)
Lus10026525 256 / 1e-82 AT5G03330 292 / 4e-97 Cysteine proteinases superfamily protein (.1.2)
Lus10010459 207 / 4e-65 AT3G22260 338 / 7e-119 Cysteine proteinases superfamily protein (.1.2.3)
Lus10027312 206 / 5e-64 AT3G22260 303 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Lus10003816 176 / 3e-53 AT3G22260 298 / 2e-103 Cysteine proteinases superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Potri.008G036700.9 pacid=42807872 polypeptide=Potri.008G036700.9.p locus=Potri.008G036700 ID=Potri.008G036700.9.v4.1 annot-version=v4.1
ATGATTTTATATGAGCAGGATCCAGATGTTGTTCGATGGGGTCTCCATGATCTAATTGATGTTTGTACACTTTCAAATTCTGGTTCATGTAATTCTGTTA
CTTGTTATGGCATGGATACATTTAACGTTGAGTATGTTAGAGAATATTATAATGACCCGTTATATGCAAGTAATGTGGAGAATGATGCTGTTATTGCTCG
TGCTCTCCAAGAAGAACTTTCAAGGATTGCTTATGTGGAAGCATCTGGGTTCAATAACACTGAACGAGAATCAATTATTACACAGCACTGGCCTGGTCCT
CATGAAACATACCATGGTTCTGAGCATGAGGATGATCAGACAGTCACTGTTCACAGTGAAAGCATGATGGATGCTGATGATTGCAGCAAAAATATGGCAG
ATTATTCTATCAAGAAGGATGAAATATTGATTCCTACTTCATCTTCTAGCAATGGAGAAAATTCCCTCGAGATGGAAGAGCTGACACTTATTTTAAATAT
AGAAAATGAATCTGCTCTTGATGGTGAAGTGGGCAAGAGGATAACTGAGATGGTTCCTGTTTCTCATGTTCCTAAAACTAATGGAGAAATACCATCGGAG
GATGAACAGATGTCAGATCATCAAAGACTGCTAGAAAGGTTAAAGGTATATTATCTTGTTGAGAATAAAGTTCAAGGAGATGGTAACTGTCAGTTTTGTT
CTCTGTCAGATCAACTCTATCGCTCTCCTGAGCACCACAAATTGGTGAGAGAACGAGTTATTGATCAGCTCAAATCTCAGCCGCAAATGTACAGCAGCTA
TGTTCCTATGGCTTATGATGACTATCTGAAGAAAATGAGCAAGAGTGGTGAATGGGGTGACCACGTTACATTGCAGGCTGCCGCAGATTCGTATGGTATC
AAGATATTTGTGATAACTTCATTCAAGGATACATGTTACATCGAGATCCTTCCAAGAGTTCAAAAGTCCAATCGAGTTATTTTCTTGAGCTTTTGGGCGG
AGGTGCACTACAATTCTATTTATCCAGAAGGAGGTAAACAGTTGGATCTTGTTTGTCAAAGCAATGAATATTGTTCTATGATACTTCTTAGTAGGGTCCA
TCTTTTTCTGGCTTCCATCTGA
AA sequence
>Potri.008G036700.9 pacid=42807872 polypeptide=Potri.008G036700.9.p locus=Potri.008G036700 ID=Potri.008G036700.9.v4.1 annot-version=v4.1
MILYEQDPDVVRWGLHDLIDVCTLSNSGSCNSVTCYGMDTFNVEYVREYYNDPLYASNVENDAVIARALQEELSRIAYVEASGFNNTERESIITQHWPGP
HETYHGSEHEDDQTVTVHSESMMDADDCSKNMADYSIKKDEILIPTSSSSNGENSLEMEELTLILNIENESALDGEVGKRITEMVPVSHVPKTNGEIPSE
DEQMSDHQRLLERLKVYYLVENKVQGDGNCQFCSLSDQLYRSPEHHKLVRERVIDQLKSQPQMYSSYVPMAYDDYLKKMSKSGEWGDHVTLQAAADSYGI
KIFVITSFKDTCYIEILPRVQKSNRVIFLSFWAEVHYNSIYPEGGKQLDLVCQSNEYCSMILLSRVHLFLASI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G04250 Cysteine proteinases superfami... Potri.008G036700 0 1
AT5G13020 AtEML3, ACK1 EMSY-like 3, Emsy N Terminus (... Potri.001G013800 2.23 0.8060
AT5G45030 Trypsin family protein (.1.2) Potri.015G121400 2.82 0.7988
AT4G20070 ATAAH allantoate amidohydrolase (.1) Potri.001G160100 3.74 0.7126
AT2G30580 BMI1A, DRIP2 DREB2A-interacting protein 2 (... Potri.013G042000 3.87 0.7512
AT4G32440 Plant Tudor-like RNA-binding p... Potri.018G030500 4.00 0.7752
AT1G32230 ATP8, CEO1, RCD... RADICAL-INDUCED CELL DEATH1, A... Potri.003G096700 5.47 0.7408 Pt-CEO1.1
AT3G47590 alpha/beta-Hydrolases superfam... Potri.013G032500 7.21 0.6944
AT1G76460 RNA-binding (RRM/RBD/RNP motif... Potri.005G256700 8.77 0.7165
AT5G54540 Uncharacterised conserved prot... Potri.011G130000 10.24 0.7115
AT5G54520 Transducin/WD40 repeat-like su... Potri.001G410500 12.12 0.7340

Potri.008G036700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.