Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04250 239 / 2e-79 Cysteine proteinases superfamily protein (.1.2) AT5G03330 212 / 2e-68 Cysteine proteinases superfamily protein (.1.2) AT3G02070 203 / 1e-66 Cysteine proteinases superfamily protein (.1) AT3G22260 171 / 5e-54 Cysteine proteinases superfamily protein (.1.2.3) AT2G39320 94 / 3e-24 Cysteine proteinases superfamily protein (.1) AT2G27350 59 / 2e-10 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6) AT5G67170 56 / 2e-09 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G036700 [exp] 278 / 3e-94 AT5G04250 372 / 2e-128 Cysteine proteinases superfamily protein (.1.2) Potri.010G225400 [exp] 259 / 9e-87 AT5G04250 360 / 2e-123 Cysteine proteinases superfamily protein (.1.2) Potri.016G094700 [exp] 223 / 8e-73 AT5G03330 316 / 9e-107 Cysteine proteinases superfamily protein (.1.2) Potri.006G125900 [exp] 222 / 2e-72 AT5G03330 329 / 1e-111 Cysteine proteinases superfamily protein (.1.2) Potri.016G019700 [exp] 195 / 2e-63 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3) Potri.006G021700 [exp] 194 / 4e-63 AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3) Potri.014G140200 [exp] 192 / 4e-62 AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1) Potri.005G140500 [exp] 62 / 2e-11 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2) Potri.009G160100 [exp] 57 / 1e-09 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038708 [exp] 233 / 2e-76 AT5G04250 367 / 2e-126 Cysteine proteinases superfamily protein (.1.2) Lus10037977 [exp] 226 / 9e-74 AT5G04250 361 / 5e-124 Cysteine proteinases superfamily protein (.1.2) Lus10026525 [exp] 216 / 6e-70 AT5G03330 292 / 4e-97 Cysteine proteinases superfamily protein (.1.2) Lus10037388 [exp] 211 / 1e-68 AT5G04250 239 / 6e-77 Cysteine proteinases superfamily protein (.1.2) Lus10001404 [exp] 212 / 2e-68 AT5G03330 327 / 9e-111 Cysteine proteinases superfamily protein (.1.2) Lus10013813 [exp] 212 / 2e-68 AT5G03330 280 / 2e-92 Cysteine proteinases superfamily protein (.1.2) Lus10023019 [exp] 212 / 2e-68 AT5G03330 325 / 4e-110 Cysteine proteinases superfamily protein (.1.2) Lus10010459 [exp] 189 / 8e-61 AT3G22260 338 / 7e-119 Cysteine proteinases superfamily protein (.1.2.3) Lus10027312 [exp] 183 / 6e-58 AT3G22260 303 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3) Lus10003816 [exp] 156 / 3e-48 AT3G22260 298 / 2e-103 Cysteine proteinases superfamily protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [poplar] [flax] Peptidase_CA PF02338 [poplar] [flax] OTU OTU-like cysteine protease
Representative CDS sequence Show only first row Show all	>Potri.008G036900.1 pacid=42807186 polypeptide=Potri.008G036900.1.p locus=Potri.008G036900 ID=Potri.008G036900.1.v4.1 annot-version=v4.1 ATGATTGTGGAGAATGATGCTGCCATTGCTCGTGCTCTCCAAGAAGAACTTTCAAGGATTGCTGCTGCAGAAGGATCTGGGCATGTTCCTAAAACTAATG GAGAAATACCATCGGAGGATGAACAGATGTCAGATCATCAAAGACTGCTAGAAAGGTTAAAGTTATATAATCTTGTTGAAAAAGAAGTTCAAGGAGATGG TAACTGTCAGTTTCGTTCTCTGTCAGATCAACTCTATGATTCTCCTGAGCACCACAAATTCGTGAGAGAACAAGTTATTGAACAGCTCAAGTCTCAGCCG CAAATGTACAGCAGCTATGTTCCTATGGCTTATGACGACTATCTGGAGAAAATGAGCAGGAGTGGTCAATGGGGTGATCACGTTACATTGCAGGCCGCTG CAGATTTGTATGGTATCAAGATATTTATGATAACTTCATTCAAGGATACATGTTGCATCGAGATCCTTCCAAAAGTGCTAAAGTCCAACAATGGAGTTAT TTACTTGAGCTTTTGGGCGGAGGTGCACTACAATCCTGTTCGTCGCATGAGGTAA
AA sequence Show only first row Show all	>Potri.008G036900.1 pacid=42807186 polypeptide=Potri.008G036900.1.p locus=Potri.008G036900 ID=Potri.008G036900.1.v4.1 annot-version=v4.1 MIVENDAAIARALQEELSRIAAAEGSGHVPKTNGEIPSEDEQMSDHQRLLERLKLYNLVEKEVQGDGNCQFRSLSDQLYDSPEHHKFVREQVIEQLKSQP QMYSSYVPMAYDDYLEKMSRSGQWGDHVTLQAAADLYGIKIFMITSFKDTCCIEILPKVLKSNNGVIYLSFWAEVHYNPVRRMR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G04250			Cysteine proteinases superfami...		Potri.008G036900 [exp]	0	1
AT2G21620		RD2	Adenine nucleotide alpha hydro...		Potri.004G156200 [exp]	2.44	0.9090	Pt-RD2.2
AT1G02305			Cysteine proteinases superfami...		Potri.002G184201 [exp]	3.00	0.9399
AT5G43260			chaperone protein dnaJ-related...		Potri.001G056601 [exp]	3.87	0.9227
AT1G68300			Adenine nucleotide alpha hydro...		Potri.008G121900 [exp]	4.69	0.8876
AT4G31750		WIN2	HOPW1-1-interacting 2 (.1)		Potri.018G013900 [exp]	6.70	0.9067
AT2G22570		NIC2, ATNIC1	A. THALIANA NICOTINAMIDASE 1, ...		Potri.007G116100 [exp]	8.36	0.8937
AT1G08230		ATGAT1	L-GAMMA-AMINOBUTYRIC ACID TRAN...		Potri.008G026700 [exp]	10.39	0.9257	PtrProT5
AT5G16010			3-oxo-5-alpha-steroid 4-dehydr...		Potri.010G245200 [exp]	15.96	0.8921
AT1G06050			Protein of unknown function (D...		Potri.007G130400 [exp]	17.02	0.9136
AT3G10120			unknown protein		Potri.016G079700 [exp]	17.43	0.8624

Compare expression of checked genes

Potri.008G036900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.