Potri.008G039800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G13810 143 / 2e-42 Restriction endonuclease, type II-like superfamily protein (.1)
AT1G67660 110 / 1e-29 Restriction endonuclease, type II-like superfamily protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G222500 260 / 7e-88 AT1G13810 242 / 1e-78 Restriction endonuclease, type II-like superfamily protein (.1)
Potri.010G054800 112 / 4e-30 AT1G67660 391 / 7e-136 Restriction endonuclease, type II-like superfamily protein (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010434 191 / 2e-60 AT1G13810 216 / 5e-68 Restriction endonuclease, type II-like superfamily protein (.1)
Lus10017632 187 / 1e-59 AT1G13810 216 / 6e-69 Restriction endonuclease, type II-like superfamily protein (.1)
Lus10033589 140 / 9e-40 AT1G13810 161 / 4e-45 Restriction endonuclease, type II-like superfamily protein (.1)
Lus10012108 86 / 1e-21 AT1G13810 113 / 2e-31 Restriction endonuclease, type II-like superfamily protein (.1)
Lus10011377 61 / 3e-12 AT1G67660 169 / 1e-53 Restriction endonuclease, type II-like superfamily protein (.1.2.3)
Lus10006437 61 / 3e-12 AT1G67660 172 / 8e-55 Restriction endonuclease, type II-like superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0236 PDDEXK PF09588 YqaJ YqaJ-like viral recombinase domain
Representative CDS sequence
>Potri.008G039800.2 pacid=42806827 polypeptide=Potri.008G039800.2.p locus=Potri.008G039800 ID=Potri.008G039800.2.v4.1 annot-version=v4.1
ATGGTTGATATTAGCAACAGAAGAAACTACTCTAGCCAGGTTTTTTTGGATCCATCTGAAAGTTTCAGTGGGGCAATTGGTTTTTGGCGTCACAGGAGAG
TCCAGCTCTGGTTAGAGAAACTTGGTGCAAAAGAACCATTTTATGGTAACATGGCTATCTGTTGGACCAATGCCAAAGAAGAGGAAGCACTTGAAAGATA
TAAGTTGATTACAGGAAATATAGTTTCGTTTCCCAAGTTTCAGCTTTCATCTGATGGGCTAGTTGACAAGTGTTCTGGGTTGAATTCCAGAGGAGTGTTG
GAAATAAAGTGTCCATTTTTTAAAGGAGAAATGTGCAGGGCTTCACCTTGGAAGCAGATCCCTCTTTATTGTGTTCCACAAGCTCAAGGTTTAATCGAAA
TACTAGACAAGGATTGGATGGATTTCTATGTTTGGACTCCTAATGGAAGCGGTCTGTTTGCATTATATCGAGACGAGGCATACTGGATGCTCTGA
AA sequence
>Potri.008G039800.2 pacid=42806827 polypeptide=Potri.008G039800.2.p locus=Potri.008G039800 ID=Potri.008G039800.2.v4.1 annot-version=v4.1
MVDISNRRNYSSQVFLDPSESFSGAIGFWRHRRVQLWLEKLGAKEPFYGNMAICWTNAKEEEALERYKLITGNIVSFPKFQLSSDGLVDKCSGLNSRGVL
EIKCPFFKGEMCRASPWKQIPLYCVPQAQGLIEILDKDWMDFYVWTPNGSGLFALYRDEAYWML

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G13810 Restriction endonuclease, type... Potri.008G039800 0 1
Potri.007G113400 1.00 0.8858
AT5G55840 Pentatricopeptide repeat (PPR)... Potri.001G368700 2.00 0.8838
AT2G35510 SRO1 similar to RCD one 1 (.1) Potri.005G149701 4.47 0.8259
AT5G55390 EDM2 ENHANCED DOWNY MILDEW 2 (.1.2) Potri.001G359900 4.58 0.8690
AT3G56320 PAP/OAS1 substrate-binding dom... Potri.019G056800 7.74 0.8372
AT1G55325 MAB2, GCT MACCHI-BOU 2, GRAND CENTRAL, R... Potri.003G220800 7.74 0.8624
AT5G64320 Pentatricopeptide repeat (PPR)... Potri.013G002800 8.71 0.8273
AT4G20020 unknown protein Potri.004G218650 8.94 0.8419
AT3G61690 nucleotidyltransferases (.1) Potri.002G169732 9.21 0.8300
AT5G06810 Mitochondrial transcription te... Potri.016G048200 9.79 0.8390

Potri.008G039800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.