Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-VMA10.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01390 145 / 2e-46 AVMA10, VMA10 vacuolar membrane ATPase 10 (.1.2) AT4G23710 136 / 4e-43 VAG2 ,VATG2 ,VHA-G2 vacuolar ATP synthase subunit G2 (.1) AT4G25950 113 / 7e-34 VATG3 vacuolar ATP synthase G3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G222000 [exp] 199 / 6e-68 AT3G01390 147 / 2e-47 vacuolar membrane ATPase 10 (.1.2) Potri.019G080700 [exp] 122 / 2e-37 AT4G25950 120 / 8e-37 vacuolar ATP synthase G3 (.1) Potri.013G108300 [exp] 94 / 4e-26 AT3G01390 64 / 2e-14 vacuolar membrane ATPase 10 (.1.2) Potri.019G133701 [exp] 74 / 1e-18 AT4G25950 74 / 1e-18 vacuolar ATP synthase G3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029418 [exp] 177 / 3e-59 AT3G01390 143 / 7e-46 vacuolar membrane ATPase 10 (.1.2) Lus10004213 [exp] 177 / 4e-59 AT3G01390 143 / 9e-46 vacuolar membrane ATPase 10 (.1.2) Lus10016977 [exp] 173 / 2e-57 AT3G01390 129 / 4e-40 vacuolar membrane ATPase 10 (.1.2) Lus10021301 [exp] 166 / 1e-54 AT4G23710 123 / 1e-37 vacuolar ATP synthase subunit G2 (.1) Lus10001543 [exp] 110 / 2e-32 AT4G25950 123 / 8e-38 vacuolar ATP synthase G3 (.1) Lus10009452 [exp] 108 / 8e-32 AT4G25950 123 / 7e-38 vacuolar ATP synthase G3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0255 [poplar] [flax] ATP_synthase PF03179 [poplar] [flax] V-ATPase_G Vacuolar (H+)-ATPase G subunit
Representative CDS sequence Show only first row Show all	>Potri.008G040300.6 pacid=42805816 polypeptide=Potri.008G040300.6.p locus=Potri.008G040300 ID=Potri.008G040300.6.v4.1 annot-version=v4.1 ATGGAGGCCAACAGGGGTCAGAATGGAATTCAACTCTTGCTTGCTGCAGAGCAAGAAGCTCAGCATATTGTCAATACTGCCAGAAATGCGAAAATGGCTA GACTGAGACAAGCCAAAGAAGAGGCTGACAAGGAAATTGCTGAATTTCGTGCTCACATGGAAGCTGAATTTCAGAGGAAGCTTACTGAGAGCAGCGGGGA CTCTGGTGCTAATGTGAAGCGATTGGAGCATGAAACTGAGGCAAAGATCGGTCACCTGAAGACAGAAGCCTCAAGGATCTCCCATGATGTTGTACAGATG CTTTTGAAGCATGTGACAGCAGTGAAAAACTAG
AA sequence Show only first row Show all	>Potri.008G040300.6 pacid=42805816 polypeptide=Potri.008G040300.6.p locus=Potri.008G040300 ID=Potri.008G040300.6.v4.1 annot-version=v4.1 MEANRGQNGIQLLLAAEQEAQHIVNTARNAKMARLRQAKEEADKEIAEFRAHMEAEFQRKLTESSGDSGANVKRLEHETEAKIGHLKTEASRISHDVVQM LLKHVTAVKN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G01390		AVMA10, VMA10	vacuolar membrane ATPase 10 (....		Potri.008G040300 [exp]	0	1	Pt-VMA10.1
AT5G62575		SDH7B, SDH7	succinate dehydrogenase 7B, su...		Potri.015G072100 [exp]	1.41	0.9463
AT1G48160			signal recognition particle 19...		Potri.012G045500 [exp]	3.74	0.9024	SRP19.1
AT5G15770		ATGNA1	glucose-6-phosphate acetyltran...		Potri.018G086400 [exp]	4.00	0.9191
AT1G09330		ECHIDNA, ECH	unknown protein		Potri.013G006250 [exp]	4.24	0.9188
AT4G20410		GAMMA-SNAP, GSN...	gamma-soluble NSF attachment p...		Potri.001G440600 [exp]	4.89	0.9104	Pt-GSNAP.2
AT5G39510		ZIG1, SGR4, ATV...	SHOOT GRAVITROPSIM 4, VESICLE ...		Potri.004G115700 [exp]	5.91	0.9168
AT4G16695			unknown protein		Potri.001G156500 [exp]	8.00	0.8870
AT4G02620			vacuolar ATPase subunit F fami...		Potri.005G217600 [exp]	9.48	0.9097	VATF.1
AT1G27330			Ribosome associated membrane p...		Potri.006G017100 [exp]	13.03	0.9057
AT5G64180			unknown protein		Potri.012G022200 [exp]	13.63	0.8527

Compare expression of checked genes

Potri.008G040300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.