Potri.008G043800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52300 291 / 2e-102 ATPQ "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G217800 322 / 2e-114 AT3G52300 281 / 1e-98 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038474 309 / 1e-109 AT3G52300 297 / 7e-105 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Lus10023337 308 / 4e-109 AT3G52300 298 / 2e-105 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Lus10023492 298 / 5e-105 AT3G52300 295 / 8e-104 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Lus10040374 297 / 1e-104 AT3G52300 293 / 3e-103 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05873 Mt_ATP-synt_D ATP synthase D chain, mitochondrial (ATP5H)
Representative CDS sequence
>Potri.008G043800.1 pacid=42806048 polypeptide=Potri.008G043800.1.p locus=Potri.008G043800 ID=Potri.008G043800.1.v4.1 annot-version=v4.1
ATGAGCGGACCATCAAAGAAAGTAGTGGATGTGGCATTTAAAGCATCGAGAACCATCGATTGGGATGGGATGGCTAAGCTTTTAGTCTCTGATGAGGCTC
GCAAAGAGTTCGCTACACTTCGTCGCGCTTTCAACGAAGTTAACTCCCAACTCGAGACCAAGTTCAGCCAGGAACCCGAACCCATAGACTGGGAATATTA
TAGAAGAGGAATTGGGTCTCGCTTGGTGGACATGTACAAACAGGCATATGAAAGCATAGAGATCCCCAAGTTTCAAGATAAAGTGACTCCAGAATACAAG
CCTAAATTTGATCAATTGTTGGTGGAATTGAAAGAAGCAGAGCAACAATCCCTGAAGGAGTCTGAGCGTCTGGAGAAAGAAATTGCTGAAGTTCAAGAAT
TGAAGACAAAAATCAGCACCATGACTGCAGAGGAGTACTTTGAGAAGCATCCTGAGCTGAAGAAAAAGTTTGATGACGAAATCCGCAATGACTATTGGGG
TTATTGA
AA sequence
>Potri.008G043800.1 pacid=42806048 polypeptide=Potri.008G043800.1.p locus=Potri.008G043800 ID=Potri.008G043800.1.v4.1 annot-version=v4.1
MSGPSKKVVDVAFKASRTIDWDGMAKLLVSDEARKEFATLRRAFNEVNSQLETKFSQEPEPIDWEYYRRGIGSRLVDMYKQAYESIEIPKFQDKVTPEYK
PKFDQLLVELKEAEQQSLKESERLEKEIAEVQELKTKISTMTAEEYFEKHPELKKKFDDEIRNDYWGY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Potri.008G043800 0 1
AT1G63000 UER1, NRS/ER "UDP-4-KETO-6-DEOXY-D-GLUCOSE-... Potri.001G112000 4.24 0.8684
AT5G22130 PNT1 PEANUT 1, mannosyltransferase ... Potri.001G031500 6.48 0.8562 Pt-PNT1.1
AT5G64813 LIP1 Light Insensitive Period1, Ras... Potri.005G085100 7.74 0.8380
AT4G29480 Mitochondrial ATP synthase sub... Potri.006G232000 8.42 0.8759
AT3G01280 VDAC1, ATVDAC1 ARABIDOPSIS THALIANA VOLTAGE D... Potri.008G194900 12.00 0.8594 Pt-POR1.1
AT5G56020 Got1/Sft2-like vescicle transp... Potri.011G164900 13.74 0.8508
AT3G24160 PMP putative type 1 membrane prote... Potri.001G049800 15.58 0.8336 Pt-PMP.1
AT3G22845 emp24/gp25L/p24 family/GOLD fa... Potri.010G081700 16.43 0.8506
AT1G43580 Sphingomyelin synthetase famil... Potri.005G193300 17.94 0.8457
AT1G51980 Insulinase (Peptidase family M... Potri.008G193200 19.69 0.8024

Potri.008G043800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.