Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G16880 190 / 1e-56 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G46100 119 / 1e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62720 113 / 1e-29 AtNG1 novel gene 1, Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G22470 114 / 2e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G09900 114 / 2e-29 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G04760 114 / 2e-29 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G07290 112 / 5e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G65560 110 / 4e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62930 110 / 4e-28 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62670 109 / 6e-28 RPF2 rna processing factor 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G217600 [exp] 290 / 4e-94 AT2G16880 677 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G050400 [exp] 127 / 2e-34 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.011G144300 [exp] 125 / 2e-33 AT1G79080 742 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G034400 [exp] 122 / 2e-32 AT3G22470 476 / 1e-161 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G050180 [exp] 121 / 3e-32 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G034200 [exp] 120 / 5e-32 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G034300 [exp] 119 / 1e-31 AT1G62930 397 / 4e-133 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.009G069600 [exp] 119 / 3e-31 AT4G28010 661 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G046000 [exp] 119 / 3e-31 AT1G63130 405 / 9e-133 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041421 [exp] 235 / 7e-72 AT2G16880 668 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10036506 [exp] 231 / 8e-72 AT2G16880 675 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10007468 [exp] 120 / 2e-31 AT5G01110 808 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10010410 [exp] 118 / 1e-30 AT5G59900 998 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10012139 [exp] 117 / 2e-30 AT5G59900 987 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10021074 [exp] 110 / 1e-28 AT1G62930 273 / 5e-86 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10040633 [exp] 111 / 3e-28 AT3G61520 586 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10008593 [exp] 110 / 3e-28 AT1G12700 400 / 7e-131 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10015397 [exp] 110 / 3e-28 AT5G46100 593 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10009201 [exp] 107 / 5e-28 AT1G12700 274 / 3e-86 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.008G044000.3 pacid=42806422 polypeptide=Potri.008G044000.3.p locus=Potri.008G044000 ID=Potri.008G044000.3.v4.1 annot-version=v4.1 ATGGGATGTTTTAAAAATGAAAAGGCAGGTAAAGCTTTGAAGCTTTGGGATGAGATGAAGGAGAAAGAGATCGCTCCAAGTGTTATCACCTATAACTCTA TTATTGCAGGCTTATGCCAAATGGGAAAAACTGATCAAGCAAGAGACAAACTGAATGAGCTTCTGGAGAGTGATTTGGTCCCTGGTGAAATTACATACAG TGCGATTATTCATGGACATTGCTGGGAAGATCAAGTTGAGAAAGCATTTCAGTTCCACAACAAAATGGTCGAGAATAAGGTTAAGCCAAATGCATTTACT TGTAATGTTCTCCTTCGTGGGATTTGCAGAGAAGGTATGCTTGGAAAACCTCTTAAGCTCTTCAACACATGGATTTCAAAGGGTAATGCCATTTCATACA ACAAGATAATTTTAGCCCTTTGCAAAGAGAAGAGATTTGAGGAGGCATCTGATCTTCTTGCAGAAGTGGACAAAAAGAAACTAGAACCTGATTGTTATAC ATATAATGCTGCTATTCTTGGTGGGCTTACTGATGCTGGAAGGACTGAGGACGCAGAGGAGTTCATATAA
AA sequence Show only first row Show all	>Potri.008G044000.3 pacid=42806422 polypeptide=Potri.008G044000.3.p locus=Potri.008G044000 ID=Potri.008G044000.3.v4.1 annot-version=v4.1 MGCFKNEKAGKALKLWDEMKEKEIAPSVITYNSIIAGLCQMGKTDQARDKLNELLESDLVPGEITYSAIIHGHCWEDQVEKAFQFHNKMVENKVKPNAFT CNVLLRGICREGMLGKPLKLFNTWISKGNAISYNKIILALCKEKRFEEASDLLAEVDKKKLEPDCYTYNAAILGGLTDAGRTEDAEEFI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G16880			Pentatricopeptide repeat (PPR)...		Potri.008G044000 [exp]	0	1
AT1G54380			spliceosome protein-related (....		Potri.007G124150 [exp]	1.00	0.9278
AT3G18840			Tetratricopeptide repeat (TPR)...		Potri.009G113500 [exp]	2.44	0.9273
AT1G61870		PPR336	pentatricopeptide repeat 336 (...		Potri.011G001100 [exp]	2.44	0.9184
AT4G32420			Cyclophilin-like peptidyl-prol...		Potri.006G250900 [exp]	2.82	0.9242
AT5G06350			ARM repeat superfamily protein...		Potri.011G095700 [exp]	3.00	0.9245
AT5G14950		GMII, ATGMII	golgi alpha-mannosidase II (.1...		Potri.001G350400 [exp]	4.47	0.9192
AT1G09820			Pentatricopeptide repeat (PPR-...		Potri.005G014500 [exp]	5.47	0.9102
AT3G04980			DNAJ heat shock N-terminal dom...		Potri.013G029500 [exp]	5.91	0.9175
AT2G30120			unknown protein		Potri.001G281400 [exp]	6.00	0.9044
AT4G03030			Galactose oxidase/kelch repeat...		Potri.005G221300 [exp]	7.21	0.9117

Compare expression of checked genes

Potri.008G044000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.