Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G16880 81 / 7e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62720 80 / 1e-18 AtNG1 novel gene 1, Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT5G39710 78 / 9e-18 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G05670 77 / 9e-18 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2) AT5G65560 76 / 6e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63630 72 / 6e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G63400 75 / 7e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G38730 74 / 2e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G64583 74 / 2e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G06000 74 / 2e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G217600 [exp] 152 / 7e-44 AT2G16880 677 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.015G105400 [exp] 85 / 2e-20 AT5G61990 773 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G141800 [exp] 84 / 6e-20 AT2G06000 588 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2) Potri.014G056400 [exp] 78 / 6e-18 AT1G02060 885 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.016G025600 [exp] 77 / 1e-17 AT3G22470 426 / 3e-141 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.017G131400 [exp] 77 / 2e-17 AT1G09680 669 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G032600 [exp] 76 / 2e-17 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G045000 [exp] 76 / 4e-17 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.017G032100 [exp] 76 / 4e-17 AT1G62930 451 / 2e-152 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041421 [exp] 110 / 3e-29 AT2G16880 668 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10036506 [exp] 107 / 5e-28 AT2G16880 675 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10040633 [exp] 87 / 6e-21 AT3G61520 586 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10018019 [exp] 83 / 2e-19 AT2G32630 590 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10042016 [exp] 81 / 6e-19 AT2G32630 600 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10036020 [exp] 81 / 9e-19 AT5G61990 592 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10019524 [exp] 81 / 1e-18 AT3G54980 716 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10024513 [exp] 81 / 1e-18 AT3G18020 777 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10004615 [exp] 77 / 1e-17 AT2G06000 531 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2) Lus10034421 [exp] 75 / 9e-17 AT2G02150 706 / 0.0 EMBRYO DEFECTIVE 2794, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF12854 [poplar] [flax] PPR_1 PPR repeat
Representative CDS sequence Show only first row Show all	>Potri.008G044050.1 pacid=42807236 polypeptide=Potri.008G044050.1.p locus=Potri.008G044050 ID=Potri.008G044050.1.v4.1 annot-version=v4.1 ATGTTGCAGAATAATGTGATGCCAGACGTTTGGACGTGCAATGTGATGATTAGTGGGTTTTGTAAACAGGGTAGGATTGATGAGGCGTTGAGGTTGAATG AAGAGATGGAAAAACTGAAGCTGTTGCCTGATGTGGTAATATATAATACTTTGATTAATGGGTGTTTTGAACATGGGAGTAGTGAGGAGGGGTTTAAATT GATTAATGGGTGTTTTGAAGCGTTGAGGTGTTTATATAACACTGTTACTTGTAATGCTTTGATAAGTGGGCATTGTAAGGTGGCGAAGATGGATGAAGCA TTCAGATTGATGGAGGAAATGGGGACGAAATGTATTGTGGATGAGGGTAGTTAA
AA sequence Show only first row Show all	>Potri.008G044050.1 pacid=42807236 polypeptide=Potri.008G044050.1.p locus=Potri.008G044050 ID=Potri.008G044050.1.v4.1 annot-version=v4.1 MLQNNVMPDVWTCNVMISGFCKQGRIDEALRLNEEMEKLKLLPDVVIYNTLINGCFEHGSSEEGFKLINGCFEALRCLYNTVTCNALISGHCKVAKMDEA FRLMEEMGTKCIVDEGS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G16880			Pentatricopeptide repeat (PPR)...		Potri.008G044050 [exp]	0	1
AT2G27228		CPuORF6	conserved peptide upstream ope...		Potri.001G216800 [exp]	1.73	0.9640
AT1G58122		CPuORF45	conserved peptide upstream ope...		Potri.007G113150 [exp]	2.82	0.9521
AT5G14280	GeBP		DNA-binding storekeeper protei...		Potri.010G056000 [exp]	3.87	0.9371
					Potri.005G187000 [exp]	4.00	0.9230
					Potri.010G080633 [exp]	4.89	0.9194
AT2G31280	bHLH	bHLH155 ,CPuORF...	conserved peptide upstream ope...		Potri.006G090033 [exp]	5.47	0.9224
AT2G31280	bHLH	bHLH155 ,CPuORF...	conserved peptide upstream ope...		Potri.005G222550 [exp]	5.91	0.8922
AT5G36930			Disease resistance protein (TI...		Potri.010G231250 [exp]	6.32	0.8790
AT2G31280	bHLH	bHLH155 ,CPuORF...	conserved peptide upstream ope...		Potri.002G040550 [exp]	7.34	0.8067
AT5G52552		CPuORF14	conserved peptide upstream ope...		Potri.017G143300 [exp]	8.77	0.8619

Compare expression of checked genes

Potri.008G044050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.