Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38905 100 / 4e-30 Low temperature and salt responsive protein family (.1) AT3G05880 85 / 4e-24 RCI2A RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) AT3G05890 81 / 1e-22 RCI2B RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) AT1G57550 72 / 3e-19 Low temperature and salt responsive protein family (.1) AT4G30650 67 / 5e-17 Low temperature and salt responsive protein family (.1) AT4G28088 64 / 7e-16 Low temperature and salt responsive protein family (.1) AT4G30660 64 / 7e-16 Low temperature and salt responsive protein family (.1.2) AT2G24040 63 / 3e-15 Low temperature and salt responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G217200 [exp] 99 / 1e-29 AT2G38905 98 / 2e-29 Low temperature and salt responsive protein family (.1) Potri.013G001600 [exp] 84 / 1e-23 AT3G05880 70 / 3e-18 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.005G002100 [exp] 78 / 1e-21 AT3G05880 68 / 1e-17 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.005G002250 [exp] 77 / 3e-21 AT3G05890 66 / 2e-16 RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) Potri.006G182500 [exp] 66 / 2e-16 AT4G28088 91 / 5e-26 Low temperature and salt responsive protein family (.1) Potri.018G105100 [exp] 61 / 1e-14 AT4G28088 91 / 1e-25 Low temperature and salt responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040370 [exp] 100 / 3e-30 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10023489 [exp] 100 / 3e-30 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10029449 [exp] 80 / 5e-22 ND 89 / 1e-25 Lus10019890 [exp] 76 / 1e-20 AT3G05880 85 / 3e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10014028 [exp] 76 / 1e-20 AT3G05880 84 / 5e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10029450 [exp] 76 / 3e-20 ND 87 / 6e-25 Lus10005948 [exp] 74 / 3e-19 ND 85 / 5e-23 Lus10036592 [exp] 66 / 3e-16 AT4G30660 116 / 4e-36 Low temperature and salt responsive protein family (.1.2) Lus10035809 [exp] 66 / 3e-16 AT4G30660 116 / 5e-36 Low temperature and salt responsive protein family (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01679 [poplar] [flax] Pmp3 Proteolipid membrane potential modulator
Representative CDS sequence Show only first row Show all	>Potri.008G044300.1 pacid=42806250 polypeptide=Potri.008G044300.1.p locus=Potri.008G044300 ID=Potri.008G044300.1.v4.1 annot-version=v4.1 ATGGGTTCAGAGACCTTCCTAGAAGTGATATTGGCGATTATCCTTCCACCCGTCGGGGTCTTCCTGCGTTATGGCTGTGGAGTGGAGTTTTGGATATGTT TGCTGTTGACCATATTGGGATATATTCCAGGGATTATATATGCCCTTTATGTATTAGTTGGATAG
AA sequence Show only first row Show all	>Potri.008G044300.1 pacid=42806250 polypeptide=Potri.008G044300.1.p locus=Potri.008G044300 ID=Potri.008G044300.1.v4.1 annot-version=v4.1 MGSETFLEVILAIILPPVGVFLRYGCGVEFWICLLLTILGYIPGIIYALYVLVG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G38905			Low temperature and salt respo...		Potri.008G044300 [exp]	0	1
AT4G12680			unknown protein		Potri.014G170800 [exp]	2.82	0.9070
AT5G50720		ATHVA22E	ARABIDOPSIS THALIANA HVA22 HOM...		Potri.015G099700 [exp]	3.87	0.9046
AT5G63030		GRXC1	glutaredoxin C1, Thioredoxin s...		Potri.012G082800 [exp]	5.91	0.9357
					Potri.018G128750 [exp]	7.21	0.9244
					Potri.010G115900 [exp]	10.81	0.9180
AT1G07430		HAI2	highly ABA-induced PP2C gene 2...		Potri.001G092100 [exp]	11.83	0.8635
AT2G47770		ATTSPO	TSPO(outer membrane tryptophan...		Potri.002G206100 [exp]	13.49	0.8924
AT2G25890			Oleosin family protein (.1)		Potri.006G234900 [exp]	13.96	0.8546
AT1G27990			unknown protein		Potri.003G168400 [exp]	14.42	0.8164
AT2G25060		AtENODL14	early nodulin-like protein 14 ...		Potri.018G128800 [exp]	16.79	0.9041

Compare expression of checked genes

Potri.008G044300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.