Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G54770 233 / 6e-77 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT1G76460 148 / 3e-43 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G22910 145 / 1e-42 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT1G20880 145 / 3e-42 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT2G46780 137 / 2e-38 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G78260 135 / 2e-38 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT1G22330 134 / 1e-37 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G33470 131 / 4e-37 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT5G11412 107 / 2e-28 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G53680 102 / 8e-27 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G216800 [exp] 409 / 4e-146 AT3G54770 216 / 4e-70 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.013G094400 [exp] 155 / 4e-46 AT1G33470 257 / 3e-86 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.019G068400 [exp] 154 / 1e-45 AT1G33470 246 / 7e-82 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.005G256700 [exp] 143 / 3e-41 AT1G76460 335 / 5e-116 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.002G179100 [exp] 142 / 5e-41 AT2G46780 275 / 2e-91 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.002G004600 [exp] 141 / 1e-40 AT1G76460 377 / 9e-133 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.002G098100 [exp] 140 / 2e-40 AT1G78260 164 / 5e-49 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.014G105101 [exp] 139 / 3e-39 AT2G46780 252 / 4e-82 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.012G022100 [exp] 127 / 1e-35 AT2G46780 161 / 1e-47 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041423 [exp] 222 / 3e-72 AT3G54770 181 / 3e-56 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10036503 [exp] 182 / 6e-57 AT3G54770 156 / 5e-47 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10002684 [exp] 137 / 1e-38 AT2G46780 228 / 1e-72 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10030202 [exp] 137 / 1e-38 AT2G46780 224 / 2e-71 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10023485 [exp] 123 / 2e-34 AT3G54770 71 / 6e-15 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10039151 [exp] 110 / 2e-28 AT1G33470 182 / 7e-57 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10043168 [exp] 81 / 3e-17 AT3G07810 456 / 2e-157 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10032579 [exp] 81 / 3e-17 AT3G07810 447 / 8e-154 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10023817 [exp] 79 / 8e-17 AT3G15010 188 / 5e-56 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10043016 [exp] 79 / 1e-16 AT3G56860 463 / 1e-160 UBP1-associated protein 2A (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.008G044700.1 pacid=42808579 polypeptide=Potri.008G044700.1.p locus=Potri.008G044700 ID=Potri.008G044700.1.v4.1 annot-version=v4.1 ATGACAATGAGCAACGGTGTAGGGCAGTTTGGTGATACCACTCTGACCAAAGTGTTTGTTGGAGGGTTAGCGTGGGAAACACCAAAAGAGGCCCTGAGAG AGCATTTCGAAAAGTATGGTGAGATCTTGGAGGCTGTGATTATTTCTGATAAAATCACTGGTAGATCCAAGGGCTACGGATTTGTTACGTTCAAGGAGGC TGGAGCGGCAAATAAGGCTTGCGAGGATGCTGCACCCATCATCAATGGCCGCCGTGCCAACTGCAACCTGGCTTCCCTTGGTGCACGCCGCCCTAGGTCT TCAACACCGGCCCCTCCTCAGCAAGGACCTAACATCATCGCTGGACCGAGGTCCACGCCAGCACCGCCAGCAAATCACGTCCAGTGGTATTATCCGGCAG GGTCAGCTGCAGCGTCACCATTTCACCATCAGCATCACCAAGCCGTTCCTTTTTATGGGTACTCTCCTGCTTACATTGCCACAGATATCAGTTACAATCA TAAGCTAAGCTACACCGGCGGGTCCTACATGAATGGGCATTTCTCTCAGGTGTATCCAGGGCAAGCTATGGTGGGTGCCAATACATTGATGCCAATGTAC CCTCTTTATCACTTCCATCAATCACAGGCGGTGGGCCTACCTGCTGCCCACATCTTCCCACCAAACACGGCGGGTCCCATGACAACGGTCCCAACTATCA TGTCCAAACCCCCATCCATTGCTCCTCCTAACGCAGGTACGGCCGGCACAGGTGAAAGCCTTAAAAGGGTTGGATAA
AA sequence Show only first row Show all	>Potri.008G044700.1 pacid=42808579 polypeptide=Potri.008G044700.1.p locus=Potri.008G044700 ID=Potri.008G044700.1.v4.1 annot-version=v4.1 MTMSNGVGQFGDTTLTKVFVGGLAWETPKEALREHFEKYGEILEAVIISDKITGRSKGYGFVTFKEAGAANKACEDAAPIINGRRANCNLASLGARRPRS STPAPPQQGPNIIAGPRSTPAPPANHVQWYYPAGSAAASPFHHQHHQAVPFYGYSPAYIATDISYNHKLSYTGGSYMNGHFSQVYPGQAMVGANTLMPMY PLYHFHQSQAVGLPAAHIFPPNTAGPMTTVPTIMSKPPSIAPPNAGTAGTGESLKRVG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G54770			RNA-binding (RRM/RBD/RNP motif...		Potri.008G044700 [exp]	0	1
AT2G26520			unknown protein		Potri.014G035400 [exp]	3.46	0.8789
AT3G07010			Pectin lyase-like superfamily ...		Potri.002G238800 [exp]	3.74	0.8630
AT5G08690			ATP synthase alpha/beta family...		Potri.008G126600 [exp]	4.89	0.8673	ATP.2
AT3G58120	bZIP	ATBZIP61	Basic-leucine zipper (bZIP) tr...		Potri.013G124400 [exp]	5.91	0.8799
AT1G62640		KAS III, KASIII	3-ketoacyl-acyl carrier protei...		Potri.001G120900 [exp]	6.70	0.8786	Pt-KAS.2
AT2G34590			Transketolase family protein (...		Potri.004G129800 [exp]	9.79	0.8659	Pt-PDH.2
AT3G25860		PLE2, LTA2	PLASTID E2 SUBUNIT OF PYRUVATE...		Potri.010G126600 [exp]	14.14	0.8332
AT2G05990		ENR1, MOD1	MOSAIC DEATH 1, ENOYL-ACP REDU...		Potri.003G212700 [exp]	14.28	0.8474	Pt-MOD1.2
AT5G13490		AAC2	ADP/ATP carrier 2 (.1.2)		Potri.009G062200 [exp]	14.38	0.8550	Pt-ANT2.1
AT1G24620			EF hand calcium-binding protei...		Potri.010G107100 [exp]	20.39	0.8190

Compare expression of checked genes

Potri.008G044700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.