Potri.008G045166 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.008G045166.1 pacid=42805842 polypeptide=Potri.008G045166.1.p locus=Potri.008G045166 ID=Potri.008G045166.1.v4.1 annot-version=v4.1
ATGAACATTTCAATGGAAAATCATTTTCACAAGAGAAGTGGATGTGCCTGCTATTACCAACTCGTTTTTCAAAGCCTCTCCAGCTGGAAAGTTTGTGCTA
ATGAGATAATTTATGAATTGTCATGTGACTCATGTTCCTGA
AA sequence
>Potri.008G045166.1 pacid=42805842 polypeptide=Potri.008G045166.1.p locus=Potri.008G045166 ID=Potri.008G045166.1.v4.1 annot-version=v4.1
MNISMENHFHKRSGCACYYQLVFQSLSSWKVCANEIIYELSCDSCS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.008G045166 0 1
Potri.008G087651 2.00 0.8810
AT4G20040 Pectin lyase-like superfamily ... Potri.003G075400 8.94 0.8449
AT5G54160 ATOMT1 O-methyltransferase 1 (.1) Potri.014G106600 11.31 0.8936 COMT4,Pt-RCOMT1.6
AT4G08850 Leucine-rich repeat receptor-l... Potri.015G123700 13.41 0.8865
Potri.002G252050 19.07 0.8776
Potri.010G007888 19.89 0.8523
Potri.019G073801 22.80 0.8776
Potri.014G003683 26.00 0.8776
Potri.017G142966 26.49 0.7447
AT4G13440 Calcium-binding EF-hand family... Potri.019G027000 30.98 0.8775

Potri.008G045166 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.