Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37250 377 / 8e-133 ADK, ATPADK1 adenosine kinase (.1) AT2G39270 346 / 2e-120 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G01820 132 / 6e-37 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G63400 120 / 1e-32 ADK1 adenylate kinase 1 (.1.2) AT5G50370 119 / 5e-32 Adenylate kinase family protein (.1) AT5G35170 117 / 2e-29 adenylate kinase family protein (.1.2) AT5G47840 99 / 2e-24 AMK2 adenosine monophosphate kinase (.1) AT5G26667 84 / 2e-19 PYR6 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) AT3G60180 82 / 2e-18 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT4G25280 81 / 1e-17 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G215300 [exp] 470 / 2e-169 AT2G37250 382 / 2e-134 adenosine kinase (.1) Potri.001G333100 [exp] 146 / 2e-42 AT3G01820 249 / 8e-83 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.015G093200 [exp] 130 / 4e-36 AT3G01820 227 / 3e-74 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.015G092800 [exp] 117 / 3e-31 AT5G63400 425 / 6e-153 adenylate kinase 1 (.1.2) Potri.012G095300 [exp] 115 / 9e-31 AT5G63400 419 / 1e-150 adenylate kinase 1 (.1.2) Potri.018G113400 [exp] 114 / 2e-28 AT5G35170 838 / 0.0 adenylate kinase family protein (.1.2) Potri.013G103400 [exp] 105 / 3e-26 AT5G47840 347 / 1e-120 adenosine monophosphate kinase (.1) Potri.019G078200 [exp] 103 / 9e-26 AT5G47840 332 / 8e-115 adenosine monophosphate kinase (.1) Potri.002G134600 [exp] 90 / 1e-21 AT5G26667 345 / 1e-122 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023476 [exp] 443 / 2e-158 AT2G37250 407 / 2e-144 adenosine kinase (.1) Lus10040358 [exp] 442 / 4e-158 AT2G37250 405 / 1e-143 adenosine kinase (.1) Lus10030296 [exp] 426 / 1e-151 AT2G37250 395 / 1e-139 adenosine kinase (.1) Lus10001984 [exp] 422 / 3e-150 AT2G37250 391 / 4e-138 adenosine kinase (.1) Lus10032057 [exp] 155 / 7e-46 AT3G01820 244 / 5e-81 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10022342 [exp] 152 / 2e-44 AT3G01820 255 / 4e-85 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10035224 [exp] 150 / 5e-44 AT3G01820 242 / 3e-80 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10022453 [exp] 116 / 6e-31 AT5G63400 411 / 2e-147 adenylate kinase 1 (.1.2) Lus10016757 [exp] 115 / 1e-30 AT5G63400 416 / 2e-149 adenylate kinase 1 (.1.2) Lus10036326 [exp] 117 / 1e-29 AT5G35170 658 / 0.0 adenylate kinase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00406 [poplar] [flax] ADK Adenylate kinase
Representative CDS sequence Show only first row Show all	>Potri.008G046100.1 pacid=42808642 polypeptide=Potri.008G046100.1.p locus=Potri.008G046100 ID=Potri.008G046100.1.v4.1 annot-version=v4.1 ATGGCTGCTCTTTCAAGAATCCCTAAAACCTCAATAAAATCACTTTCTTCTTGTATATCTCGAAGTTTTTCTATAACTACGTTGAATTCCGAGATTGACC TCAAAGTACCTTCTTTTCTTTCTCACAACTCTCTACCTCTCCGTCAGGAACCTAAGGAAGGGAATATCCAGTGGGTTTTTCTTGGTTGTCCTGGTGTAGG TAAAGGTACCTATGCGTCGCGTCTTTCCAATTTTCTCGGTGTTCCTCACATCGCCACCGGTGATCTGGTTCGCGAGGAGGTCAATTCCTCGGGCCCACTT GCCTCCCAGCTTAAGGAGACTGTGAATCAAGGGAAATTAGTTTCTGATGAGATCATTATAAGCTTACTGTCAAAACGTCTTCAAGCTGGAGAAGCTAAGG GTGAATCTGGTTTCATTCTTGATGGTTTCCCTCGAACTATTAGACAAGCGGAAATACTAGAGGGAGTAACAGACATTGACTTGGTGGTGAACCTCAAGCT TCGAGAAGAAGCGCTGCTTGCAAAATGCCTTGGGAGAAGGATTTGCGTTGAGTGTGGAAGAAATTACAACATTGCTTGCATTGACATCAAGGGTGAGAAC GGGAATCCTGGAATTTATATGGATCCACTTCCTGCTCCTCCACAATGTGCACCAAAGCTTATCCAACGAGCTGATGACACTGAAGAAGTTGTTAAGGAGC GACTACGTATTTATTATGAAAAGAGTCAACCTGTTGAGGAGTTCTACCGCAGTCGTGGGAAGTTGTTGGAGTTTGATCTTCCTGGAGGAATTCCAGAATC CTGGCCAAAGCTGCTGGAAGCTCTGAATCTTGACCACGAGGATAAATGCTCTGCAGCAGCATGA
AA sequence Show only first row Show all	>Potri.008G046100.1 pacid=42808642 polypeptide=Potri.008G046100.1.p locus=Potri.008G046100 ID=Potri.008G046100.1.v4.1 annot-version=v4.1 MAALSRIPKTSIKSLSSCISRSFSITTLNSEIDLKVPSFLSHNSLPLRQEPKEGNIQWVFLGCPGVGKGTYASRLSNFLGVPHIATGDLVREEVNSSGPL ASQLKETVNQGKLVSDEIIISLLSKRLQAGEAKGESGFILDGFPRTIRQAEILEGVTDIDLVVNLKLREEALLAKCLGRRICVECGRNYNIACIDIKGEN GNPGIYMDPLPAPPQCAPKLIQRADDTEEVVKERLRIYYEKSQPVEEFYRSRGKLLEFDLPGGIPESWPKLLEALNLDHEDKCSAAA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G37250		ADK, ATPADK1	adenosine kinase (.1)		Potri.008G046100 [exp]	0	1
AT2G44350		CSY4, ATCS	CITRATE SYNTHASE 4, Citrate sy...		Potri.001G230500 [exp]	2.44	0.7921	ATCS.2
AT1G43710		EMB1075	embryo defective 1075, Pyridox...		Potri.002G069800 [exp]	7.48	0.7332
AT4G01660		ATABC1, ATATH10...	ABC transporter 1 (.1)		Potri.002G185400 [exp]	9.00	0.8032
AT5G61510			GroES-like zinc-binding alcoho...		Potri.004G233800 [exp]	9.59	0.7885	Pt-TED2.2
AT5G37850		SOS4, ATSOS4	SALT OVERLY SENSITIVE 4, pfkB-...		Potri.017G129000 [exp]	10.09	0.7114
AT3G13224			RNA-binding (RRM/RBD/RNP motif...		Potri.001G370300 [exp]	14.00	0.7759
AT5G19380		CLT1	CRT (chloroquine-resistance tr...		Potri.009G069400 [exp]	17.49	0.7571
AT1G08410			P-loop containing nucleoside t...		Potri.009G017000 [exp]	21.33	0.7833
AT3G28970		AAR3	antiauxin-resistant 3, Domain ...		Potri.017G084300 [exp]	23.55	0.7910
AT5G03340			ATPase, AAA-type, CDC48 protei...		Potri.006G125500 [exp]	24.41	0.6928	CDC48.3

Compare expression of checked genes

Potri.008G046100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.