Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59970 162 / 1e-53 Histone superfamily protein (.1) AT5G59690 162 / 1e-53 Histone superfamily protein (.1) AT3G46320 162 / 1e-53 Histone superfamily protein (.1) AT3G53730 162 / 1e-53 Histone superfamily protein (.1) AT3G45930 162 / 1e-53 Histone superfamily protein (.1) AT2G28740 162 / 1e-53 HIS4 histone H4 (.1) AT1G07820 162 / 1e-53 Histone superfamily protein (.1.2) AT1G07660 162 / 1e-53 Histone superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G013300 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.007G013500 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.007G012500 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.006G168100 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.010G214000 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.010G213900 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G092900 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G093000 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G092666 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005448 [exp] 162 / 1e-53 AT2G28740 199 / 2e-68 histone H4 (.1) Lus10041919 [exp] 162 / 1e-53 AT5G59970 199 / 2e-68 Histone superfamily protein (.1) Lus10019956 [exp] 162 / 1e-53 AT3G46320 199 / 2e-68 Histone superfamily protein (.1) Lus10040849 [exp] 162 / 1e-53 AT3G53730 199 / 2e-68 Histone superfamily protein (.1) Lus10038481 [exp] 162 / 1e-53 AT3G53730 199 / 2e-68 Histone superfamily protein (.1) Lus10014264 [exp] 162 / 1e-53 AT5G59690 199 / 2e-68 Histone superfamily protein (.1) Lus10028464 [exp] 162 / 1e-53 AT5G59970 199 / 2e-68 Histone superfamily protein (.1) Lus10025964 [exp] 162 / 1e-53 AT2G28740 199 / 2e-68 histone H4 (.1) Lus10015492 [exp] 162 / 1e-53 AT1G07820 199 / 2e-68 Histone superfamily protein (.1.2) Lus10004949 [exp] 162 / 1e-53 AT3G53730 199 / 2e-68 Histone superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [poplar] [flax] Histone PF15511 [poplar] [flax] CENP-T_C Centromere kinetochore component CENP-T histone fold
Representative CDS sequence Show only first row Show all	>Potri.008G047500.1 pacid=42808132 polypeptide=Potri.008G047500.1.p locus=Potri.008G047500 ID=Potri.008G047500.1.v4.1 annot-version=v4.1 ATGTCTGGACGTGGAAAGGGAGGCAAGGGTCTGGGAAAGGGAGGAGCCAAGCGTCACCGTAAGGTTCTTCGTGATAACATTCAAGGTATCACAAAGCCTG CAATCCGCCGTCTTGCTCGTAGGGGTGGGGTCAAGCGTATCAGTGGTTTGATCTATGAAGAGACTCGTGGTGTACTCAAGATCTTCCTTGAAAATGTTAT AAGAGATGCTGTGACCTACACCGAGCATGCTCGCCGCAAGACTGTCACTGCCATGGATGTGGTGTACGCACTCAAGAGGCAGGGAAGAACTCTATACGGG TTCGGTGGTTAG
AA sequence Show only first row Show all	>Potri.008G047500.1 pacid=42808132 polypeptide=Potri.008G047500.1.p locus=Potri.008G047500 ID=Potri.008G047500.1.v4.1 annot-version=v4.1 MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYG FGG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G59970			Histone superfamily protein (....		Potri.008G047500 [exp]	0	1
AT5G02560		HTA12	histone H2A 12 (.1.2)		Potri.006G082300 [exp]	1.00	0.8910
AT1G07790		HTB1	Histone superfamily protein (....		Potri.010G231300 [exp]	7.48	0.8629
AT5G27740		RFC3, EMB251, E...	replication factor C 3, EMBRYO...		Potri.019G040000 [exp]	7.74	0.8440
AT1G54690		HTA3 ,G-H2AX ,G...	histone H2A 3, GAMMA H2AX, gam...		Potri.005G040800 [exp]	9.74	0.8248
AT1G07790		HTB1	Histone superfamily protein (....		Potri.010G230801 [exp]	10.39	0.7921
AT4G31360			selenium binding (.1)		Potri.018G004901 [exp]	10.58	0.8288
AT5G56130		THO3, AtTEX1	Transducin/WD40 repeat-like su...		Potri.001G470900 [exp]	13.11	0.7488
AT1G07790		HTB1	Histone superfamily protein (....		Potri.010G230600 [exp]	15.09	0.8242	HISH2.2,HTB901
AT3G27060		ATTSO2, TSO2	TSO MEANING 'UGLY' IN CHINESE ...		Potri.001G329700 [exp]	17.14	0.7816
AT1G21690		RFC4, EMB1968	replication factor C 4, embryo...		Potri.005G181300 [exp]	18.33	0.7435

Compare expression of checked genes

Potri.008G047500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.