Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RPL35.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02610 177 / 1e-58 Ribosomal L29 family protein (.1.2) AT2G39390 176 / 2e-58 Ribosomal L29 family protein (.1) AT3G55170 175 / 6e-58 Ribosomal L29 family protein (.1.2) AT3G09500 174 / 1e-57 Ribosomal L29 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G212300 [exp] 186 / 4e-62 AT2G39390 213 / 4e-73 Ribosomal L29 family protein (.1) Potri.006G214200 [exp] 184 / 2e-61 AT2G39390 186 / 3e-62 Ribosomal L29 family protein (.1) Potri.006G214100 [exp] 181 / 3e-60 AT2G39390 189 / 2e-63 Ribosomal L29 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025292 [exp] 184 / 3e-61 AT5G02610 221 / 5e-76 Ribosomal L29 family protein (.1.2) Lus10003306 [exp] 181 / 5e-60 AT3G09500 218 / 6e-75 Ribosomal L29 family protein (.1) Lus10019179 [exp] 177 / 8e-59 AT5G02610 210 / 7e-72 Ribosomal L29 family protein (.1.2) Lus10030314 [exp] 177 / 1e-58 AT3G09500 214 / 2e-73 Ribosomal L29 family protein (.1) Lus10024437 [exp] 176 / 2e-58 AT5G02610 218 / 6e-75 Ribosomal L29 family protein (.1.2) Lus10023449 [exp] 175 / 1e-57 AT5G02610 209 / 5e-71 Ribosomal L29 family protein (.1.2) Lus10019180 [exp] 137 / 5e-43 AT5G02610 172 / 4e-57 Ribosomal L29 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0346 [poplar] [flax] Ribo_L29 PF00831 [poplar] [flax] Ribosomal_L29 Ribosomal L29 protein
Representative CDS sequence Show only first row Show all	>Potri.008G048800.2 pacid=42806348 polypeptide=Potri.008G048800.2.p locus=Potri.008G048800 ID=Potri.008G048800.2.v4.1 annot-version=v4.1 ATGGCAAGAATCAAGGTTCATGAGTTGAGAAACAAATCAAAGGCAGATCTTTTGGCTCAGTTGAAGGATCTCAAAGCGGAGCTTGCTCTCCTTCGCGTTG CTAAGGTCACCGGAGGTGCTCCTAACAAGCTCTCCAAGATCAAGGTTGTGAGGTTGTCCATTGCACAGGTGTTGACTGTTATTTCACAGAAGCAGAAGGC TATATTGAGGGATGCATACAAGAACAAGAAGTTTTTGCCTCTTGATCTGCGTCCCAAGAAGACCAGGGCCATCCGCAGGAGGCTTACTAAGCATCAGCTA TCACTGAAGACTGAGCGCGAAAAGAATAGAGAGATGTACTTCCCAATGAGAAAGTATGCTATTAAGGTGTAG
AA sequence Show only first row Show all	>Potri.008G048800.2 pacid=42806348 polypeptide=Potri.008G048800.2.p locus=Potri.008G048800 ID=Potri.008G048800.2.v4.1 annot-version=v4.1 MARIKVHELRNKSKADLLAQLKDLKAELALLRVAKVTGGAPNKLSKIKVVRLSIAQVLTVISQKQKAILRDAYKNKKFLPLDLRPKKTRAIRRRLTKHQL SLKTEREKNREMYFPMRKYAIKV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G02610			Ribosomal L29 family protein ...		Potri.008G048800 [exp]	0	1	RPL35.1
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Potri.005G211200 [exp]	1.41	0.9799
AT4G00100		PFL2, ATRPS13A	POINTED FIRST LEAF 2, ribosoma...		Potri.012G128600 [exp]	2.44	0.9715	Pt-RPS13.2
AT5G61170			Ribosomal protein S19e family ...		Potri.017G092200 [exp]	3.00	0.9688	Pt-RPS19.2
AT2G32060			Ribosomal protein L7Ae/L30e/S1...		Potri.002G056200 [exp]	3.00	0.9649	Pt-RPS12.2
AT3G11940		AML1, ATRPS5A	ARABIDOPSIS MINUTE-LIKE 1, rib...		Potri.006G197700 [exp]	3.46	0.9687	RPS5.2
AT5G09500			Ribosomal protein S19 family p...		Potri.005G219700 [exp]	6.48	0.9670
AT2G09990			Ribosomal protein S5 domain 2-...		Potri.008G150000 [exp]	6.92	0.9683
AT3G52580			Ribosomal protein S11 family p...		Potri.009G019400 [exp]	8.48	0.9628
AT3G16080			Zinc-binding ribosomal protein...		Potri.003G053100 [exp]	8.77	0.9629	RPL37.2
AT3G05560			Ribosomal L22e protein family ...		Potri.013G015300 [exp]	9.32	0.9507	Pt-RPL22.3

Compare expression of checked genes

Potri.008G048800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.