Potri.008G049200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G28670 276 / 3e-90 ESB1 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT1G07730 268 / 5e-88 Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT2G39430 197 / 6e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G55230 176 / 3e-53 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G24020 149 / 3e-43 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G13580 145 / 4e-42 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G28671 99 / 6e-24 unknown protein
AT2G21100 64 / 7e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 63 / 9e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 63 / 9e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G211800 389 / 2e-136 AT2G28670 257 / 6e-83 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.010G211900 211 / 1e-65 AT2G39430 249 / 3e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.008G049100 201 / 6e-62 AT2G39430 251 / 6e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G054100 166 / 1e-49 AT4G13580 308 / 3e-106 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G054000 156 / 4e-46 AT3G24020 352 / 5e-124 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G174300 155 / 7e-46 AT3G24020 315 / 2e-109 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.010G212000 103 / 4e-26 AT1G07730 103 / 1e-25 Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.003G216300 63 / 2e-11 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.003G216400 61 / 6e-11 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006317 284 / 1e-95 AT2G28670 271 / 1e-89 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Lus10029585 181 / 2e-57 AT2G28670 166 / 6e-53 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Lus10030318 153 / 8e-45 AT3G55230 276 / 2e-93 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10011767 150 / 8e-44 AT3G24020 339 / 7e-119 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10023689 150 / 1e-43 AT3G24020 336 / 1e-117 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10003301 142 / 4e-38 AT3G55230 254 / 2e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025063 64 / 1e-11 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10021084 62 / 2e-11 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034482 63 / 3e-11 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 62 / 3e-11 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Potri.008G049200.1 pacid=42806369 polypeptide=Potri.008G049200.1.p locus=Potri.008G049200 ID=Potri.008G049200.1.v4.1 annot-version=v4.1
ATGGAAATTCACAAAATTCTCTCTACCACAAACAAGGCCATAGCCTGTCTTCTGTTCCTCACTCTTACCATTGTATTTACTACCTCAGCTAGAACCCTGG
ATGAGCAGCCAGAGGTACCTGTTGTTCCCCCGGAGTCAGACAATGCAGTCGATGATACTGTCACCAGTGTTCCACCACTACCTACACCATTAGCACCCAC
ACAGCCTAATCCAACTGGGGCTGCAAGCACTAGTGCCACGATAAGTAATCCTGGTCATACCTTAAGCTTCTTCATGCATGACATTCTTGGTGGAACAAAC
CCCTCGGCTAGAGCCGTGACTGGCATAGTCAGCAACCCGGCAGTCTCTGGCCAAGTCCCATTTGCCAAACCTAATGGTGCAAACCTCCCAATAAATAATG
GCGTGCCCCAAAATAGCAACAATAACGGCCTTATAAACAACAACAACCTACCTTTCCTCACTGGCCTTGGTGGCACCACACAGCCTGTGGTTCAAAACAA
TGGTAATAACTTCAACAATGCATTTAACTTGCCACTGAGCAATGGAGGCAATCTTCCATCTGGTTCCACTCTTCAACAGCTCATGTTTGGAACCATCACT
GTGATCGACGACGAACTAACCGAAGGGCATGATTTACGGTCAAGTTTTGTAGGTAAGGCACAAGGGTTCTATGTGGCTAGTTCTCTGGATGGTACCAGCC
AAACTATGGCATTTACAGCTATGTTTCAGAGTGGTCATTATGCTGATAGCCTTAGCTTTTTCGGGGTTCTCAGAACAGGAGTCTCCGAGTCTCAGCTTGC
TATCATGGGTGGAACTGGAAAGTATGTCAATGCTCAGGGTTATGCTATTATTAAGATCATCCCTTCTACCAATCAGAATACGACCGATGGTGTTGAGACC
TTGCTGGAGTTCGTTGTTTATGTTAGCTACTAA
AA sequence
>Potri.008G049200.1 pacid=42806369 polypeptide=Potri.008G049200.1.p locus=Potri.008G049200 ID=Potri.008G049200.1.v4.1 annot-version=v4.1
MEIHKILSTTNKAIACLLFLTLTIVFTTSARTLDEQPEVPVVPPESDNAVDDTVTSVPPLPTPLAPTQPNPTGAASTSATISNPGHTLSFFMHDILGGTN
PSARAVTGIVSNPAVSGQVPFAKPNGANLPINNGVPQNSNNNGLINNNNLPFLTGLGGTTQPVVQNNGNNFNNAFNLPLSNGGNLPSGSTLQQLMFGTIT
VIDDELTEGHDLRSSFVGKAQGFYVASSLDGTSQTMAFTAMFQSGHYADSLSFFGVLRTGVSESQLAIMGGTGKYVNAQGYAIIKIIPSTNQNTTDGVET
LLEFVVYVSY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G28670 ESB1 ENHANCED SUBERIN 1, Disease re... Potri.008G049200 0 1
AT2G28670 ESB1 ENHANCED SUBERIN 1, Disease re... Potri.010G211800 1.41 0.9826
AT2G37740 C2H2ZnF ATZFP10, ZFP10 zinc-finger protein 10 (.1) Potri.016G101400 3.87 0.9622 RBE.1
AT4G22810 AT-hook Predicted AT-hook DNA-binding ... Potri.003G116900 4.00 0.9744
AT1G13480 Protein of unknown function (D... Potri.008G109500 4.79 0.9405
AT4G35160 O-methyltransferase family pro... Potri.011G059500 6.63 0.9612 Pt-OOMT2.14,FOMT7
AT3G09220 LAC7 laccase 7 (.1) Potri.006G094100 6.92 0.9585 LAC110a
AT3G24020 Disease resistance-responsive ... Potri.001G054000 8.00 0.9563
AT2G39430 Disease resistance-responsive ... Potri.008G049100 8.06 0.9607
AT3G46280 protein kinase-related (.1) Potri.013G030866 8.77 0.9574
AT3G24020 Disease resistance-responsive ... Potri.003G174300 15.29 0.9537

Potri.008G049200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.