Plant FIBer expression Database

Potri.008G051100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G39500 66 / 1e-16 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G209501
[exp]
37 / 4e-05 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011964
[exp]
45 / 3e-08 AT2G39500 54 / 5e-12 unknown protein
PFAM info
Representative CDS sequence
>Potri.008G051100.1 pacid=42808513 polypeptide=Potri.008G051100.1.p locus=Potri.008G051100 ID=Potri.008G051100.1.v4.1 annot-version=v4.1
ATGATTAACAAATTGGAAGCAAAGAAACTCCTCAAGGACAAGAAATTATGGTTTGCTTCTTTTTTGATTGCCTGGGCTGCTGCTCTCCAGGGTCACATGA
TGTGGTTGCGGAGACAGGACTCTTTCAAGCAGAAGTTTGGAACATTAAACGAAGATAATAGTGATGTTGCACAAGAGTGA
AA sequence
>Potri.008G051100.1 pacid=42808513 polypeptide=Potri.008G051100.1.p locus=Potri.008G051100 ID=Potri.008G051100.1.v4.1 annot-version=v4.1
MINKLEAKKLLKDKKLWFASFLIAWAAALQGHMMWLRRQDSFKQKFGTLNEDNSDVAQE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G39500 unknown protein Potri.008G051100
[exp]
0 1
AT4G25315 Expressed protein (.1.2) Potri.004G189300
[exp]
3.00 0.7984
AT3G19508 unknown protein Potri.009G094200
[exp]
7.61 0.7476
AT4G14110 FUS7, EMB143, C... FUSCA 7, EMBRYO DEFECTIVE 143,... Potri.001G207900
[exp]
8.24 0.7389 EMB143.2
AT3G13920 RH4, TIF4A1, EI... eukaryotic translation initiat... Potri.003G043700
[exp]
8.94 0.7354
AT2G06010 ORG4 OBP3-responsive gene 4 (.1) Potri.018G065800
[exp]
8.94 0.7121 ORG4.2
AT5G14105 unknown protein Potri.017G066388
[exp]
10.95 0.7326
AT5G58005 Cytochrome c oxidase, subunit ... Potri.006G186500
[exp]
11.61 0.6896
AT2G18290 EMB2783, APC10 EMBRYO DEFECTIVE 2783, anaphas... Potri.005G121700
[exp]
13.11 0.6302
AT4G35490 MRPL11 mitochondrial ribosomal protei... Potri.007G058600
[exp]
14.17 0.7396
AT1G55300 TAF7 TBP-associated factor 7 (.1.2) Potri.003G218700
[exp]
15.00 0.7094

Potri.008G051100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.