Potri.008G052451 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G54980 88 / 2e-23 Uncharacterised protein family (UPF0497) (.1)
AT1G17200 76 / 1e-18 Uncharacterised protein family (UPF0497) (.1), Uncharacterised protein family (UPF0497) (.2)
AT3G14380 54 / 3e-10 Uncharacterised protein family (UPF0497) (.1)
AT4G16442 45 / 6e-07 Uncharacterised protein family (UPF0497) (.1)
AT2G35760 41 / 1e-05 Uncharacterised protein family (UPF0497) (.1)
AT3G16300 41 / 1e-05 Uncharacterised protein family (UPF0497) (.1)
AT1G79780 37 / 0.0005 Uncharacterised protein family (UPF0497) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G208300 148 / 2e-47 AT5G54980 176 / 2e-56 Uncharacterised protein family (UPF0497) (.1)
Potri.011G140200 72 / 4e-17 AT1G17200 223 / 3e-74 Uncharacterised protein family (UPF0497) (.1), Uncharacterised protein family (UPF0497) (.2)
Potri.001G436400 68 / 2e-15 AT1G17200 245 / 1e-82 Uncharacterised protein family (UPF0497) (.1), Uncharacterised protein family (UPF0497) (.2)
Potri.006G016900 39 / 0.0001 AT2G35760 250 / 4e-85 Uncharacterised protein family (UPF0497) (.1)
Potri.016G008800 39 / 0.0001 AT2G35760 253 / 2e-86 Uncharacterised protein family (UPF0497) (.1)
Potri.001G188000 37 / 0.0005 AT3G16300 131 / 5e-38 Uncharacterised protein family (UPF0497) (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021788 103 / 2e-29 AT5G54980 177 / 6e-57 Uncharacterised protein family (UPF0497) (.1)
Lus10034604 100 / 3e-28 AT5G54980 176 / 1e-56 Uncharacterised protein family (UPF0497) (.1)
Lus10026196 67 / 3e-15 AT1G17200 241 / 1e-81 Uncharacterised protein family (UPF0497) (.1), Uncharacterised protein family (UPF0497) (.2)
Lus10042471 67 / 3e-15 AT1G17200 242 / 6e-82 Uncharacterised protein family (UPF0497) (.1), Uncharacterised protein family (UPF0497) (.2)
Lus10039060 43 / 3e-06 AT2G35760 242 / 5e-82 Uncharacterised protein family (UPF0497) (.1)
Lus10038800 43 / 5e-06 AT2G35760 243 / 2e-82 Uncharacterised protein family (UPF0497) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0396 Marvel-like PF04535 DUF588 Domain of unknown function (DUF588)
Representative CDS sequence
>Potri.008G052451.1 pacid=42808534 polypeptide=Potri.008G052451.1.p locus=Potri.008G052451 ID=Potri.008G052451.1.v4.1 annot-version=v4.1
ATGTTTTTTGTTAGTGGAATCTGTGCTAGTTATGCTTTTCTTGCTGCTGTCTCCACATGGATCAGATGCTTTGTTACTAAGGCTTGGCTGTTCTTTGTCT
CTGACCAGATTGTAGCTTACTTGATGGTTACATCGGGGACCGCGGTCTTCGAGATATTATACCTGGCTTACAATGGTGATAGAGAAGTCGTATGGAGTGA
AGCCCTCTCTTCTTATGGGAAGTTTTGCTATAGAGTGAAGGTACAGTGA
AA sequence
>Potri.008G052451.1 pacid=42808534 polypeptide=Potri.008G052451.1.p locus=Potri.008G052451 ID=Potri.008G052451.1.v4.1 annot-version=v4.1
MFFVSGICASYAFLAAVSTWIRCFVTKAWLFFVSDQIVAYLMVTSGTAVFEILYLAYNGDREVVWSEALSSYGKFCYRVKVQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G54980 Uncharacterised protein family... Potri.008G052451 0 1
AT3G18670 Ankyrin repeat family protein ... Potri.011G015750 2.82 0.8495
AT2G18420 Gibberellin-regulated family p... Potri.012G076700 7.93 0.7649
AT1G63860 Disease resistance protein (TI... Potri.019G097720 9.94 0.8393
AT1G70210 ATCYCD1;1, CYCD... CYCLIN D1;1 (.1) Potri.007G005700 11.48 0.7535
AT5G03720 HSF AT-HSFA3 ARABIDOPSIS THALIANA HEAT SHOC... Potri.006G115700 11.66 0.7511
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Potri.006G137100 13.41 0.7565
AT3G44110 ATJ3 DNAJ homologue 3 (.1.2) Potri.014G055300 14.38 0.8025
AT1G65790 ARK1 receptor kinase 1 (.1) Potri.004G024316 17.29 0.7643
AT2G40410 Staphylococcal nuclease homolo... Potri.010G182500 18.13 0.7340
Potri.019G002628 18.43 0.8016

Potri.008G052451 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.