Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02530 97 / 1e-24 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT5G59950 94 / 6e-24 RNA-binding (RRM/RBD/RNP motifs) family protein AT5G37720 80 / 3e-18 DIP2, ALY4 interacting with DNA-binding domain of Zn-finger PARP 1, ALWAYS EARLY 4 (.1.2) AT1G66260 78 / 2e-17 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT2G23350 42 / 0.0001 PABP4, PAB4 poly(A) binding protein 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G208000 [exp] 116 / 2e-32 AT5G59950 138 / 8e-40 RNA-binding (RRM/RBD/RNP motifs) family protein Potri.001G236900 [exp] 100 / 1e-26 AT5G59950 187 / 2e-59 RNA-binding (RRM/RBD/RNP motifs) family protein Potri.016G093944 [exp] 100 / 2e-26 AT5G59950 196 / 1e-62 RNA-binding (RRM/RBD/RNP motifs) family protein Potri.017G129900 [exp] 89 / 1e-21 AT1G66260 216 / 3e-69 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.004G087000 [exp] 86 / 1e-20 AT5G37720 213 / 2e-68 interacting with DNA-binding domain of Zn-finger PARP 1, ALWAYS EARLY 4 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004946 [exp] 101 / 1e-26 AT5G59950 209 / 3e-67 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10005445 [exp] 101 / 1e-26 AT5G59950 210 / 9e-68 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10024413 [exp] 99 / 1e-25 AT5G59950 219 / 1e-71 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10025329 [exp] 99 / 1e-25 AT5G59950 224 / 2e-73 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10005895 [exp] 95 / 3e-24 AT5G02530 185 / 8e-58 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10023417 [exp] 94 / 1e-23 AT5G59950 130 / 3e-37 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10000446 [exp] 83 / 3e-19 AT5G37720 211 / 1e-66 interacting with DNA-binding domain of Zn-finger PARP 1, ALWAYS EARLY 4 (.1.2) Lus10010982 [exp] 83 / 4e-19 AT5G37720 209 / 7e-66 interacting with DNA-binding domain of Zn-finger PARP 1, ALWAYS EARLY 4 (.1.2) Lus10040299 [exp] 58 / 3e-10 AT5G59950 77 / 1e-16 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10016174 [exp] 45 / 6e-06 AT3G52380 275 / 3e-91 PIGMENT DEFECTIVE 322, chloroplast RNA-binding protein 33 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.008G052601.2 pacid=42806110 polypeptide=Potri.008G052601.2.p locus=Potri.008G052601 ID=Potri.008G052601.2.v4.1 annot-version=v4.1 ATGATGATGTTGAGGTTTGGGGTATTATGGGAATGTACGTGTGCAGTAGCTAAGGCCGTGATGTTCTTTCATGACGATGATAAAAAAAAGGCAGCAGGGC ACTATGTTGTCACGTGTCCTATAATCGAGGTGATTTTCTCCGAGGTTGGTGATTTGTTGAGGTGCTCACTTCATTATGATATGAGTGGGAGATCAAAGGG AACAGCCGAAGTTGTATTTGCACTCCAAACAGATGCTCTAGCAGCTATCAAGAGATACAATAATGTTCAGCTTGATGGGAAGCCCCTGAAAATTGAGCTT GTAGGGGATAATGTGATAACTCCTGTCCCTGTGCTTGTAACAACAACTACCAACTTGGCAAAACCAAAAATGTCATTAGAAGTGTTCAAGAAAGAATTGG TGCGAGGGAAGGGCCATGGCAGCGGTCAAGAATTGGCCAGAGGCCACAGCCAGGGAGACACCATGTCGAGAAGCTTACTGCAGAAGCACTTGATTCTGAC CTGGACAGACATACCACCTTGA
AA sequence Show only first row Show all	>Potri.008G052601.2 pacid=42806110 polypeptide=Potri.008G052601.2.p locus=Potri.008G052601 ID=Potri.008G052601.2.v4.1 annot-version=v4.1 MMMLRFGVLWECTCAVAKAVMFFHDDDKKKAAGHYVVTCPIIEVIFSEVGDLLRCSLHYDMSGRSKGTAEVVFALQTDALAAIKRYNNVQLDGKPLKIEL VGDNVITPVPVLVTTTTNLAKPKMSLEVFKKELVRGKGHGSGQELARGHSQGDTMSRSLLQKHLILTWTDIPP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G02530			RNA-binding (RRM/RBD/RNP motif...		Potri.008G052601 [exp]	0	1
AT1G48100			Pectin lyase-like superfamily ...		Potri.010G152000 [exp]	2.23	0.7422
AT1G48100			Pectin lyase-like superfamily ...		Potri.008G100500 [exp]	2.44	0.7363
AT3G03770			Leucine-rich repeat protein ki...		Potri.008G014300 [exp]	3.87	0.7282
AT3G52990			Pyruvate kinase family protein...		Potri.008G027100 [exp]	16.97	0.7094
AT3G61490			Pectin lyase-like superfamily ...		Potri.002G162400 [exp]	28.49	0.6250
AT5G65640	bHLH	bHLH093	beta HLH protein 93 (.1.2)		Potri.002G108400 [exp]	31.52	0.5832
AT1G03010			Phototropic-responsive NPH3 fa...		Potri.002G209700 [exp]	31.98	0.6587
AT3G23805		RALFL24	ralf-like 24 (.1)		Potri.001G320700 [exp]	33.46	0.6866
AT3G44150			unknown protein		Potri.006G201600 [exp]	33.49	0.6165
AT3G16300			Uncharacterised protein family...		Potri.003G050400 [exp]	34.35	0.6725

Compare expression of checked genes

Potri.008G052601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.