Potri.008G053200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12587 67 / 2e-17 Oligosaccaryltransferase (.1)
AT5G02502 64 / 2e-16 Oligosaccaryltransferase (.1)
AT3G09470 41 / 2e-06 Major facilitator superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G207100 72 / 9e-20 AT3G12587 66 / 4e-17 Oligosaccaryltransferase (.1)
Potri.008G053300 71 / 5e-19 AT3G12587 64 / 2e-16 Oligosaccaryltransferase (.1)
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10215 Ost4 Oligosaccaryltransferase
Representative CDS sequence
>Potri.008G053200.2 pacid=42806571 polypeptide=Potri.008G053200.2.p locus=Potri.008G053200 ID=Potri.008G053200.2.v4.1 annot-version=v4.1
ATGTTTGATGATCAAGATCTGGGTTTTTGTGCCAATTTTCTTGGCATTTTTATATTTGTTCTGGTGATCGCATATCATTATGTGGTGGCTGATCCAAAGT
ACGAAGGCAACTGA
AA sequence
>Potri.008G053200.2 pacid=42806571 polypeptide=Potri.008G053200.2.p locus=Potri.008G053200 ID=Potri.008G053200.2.v4.1 annot-version=v4.1
MFDDQDLGFCANFLGIFIFVLVIAYHYVVADPKYEGN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G12587 Oligosaccaryltransferase (.1) Potri.008G053200 0 1
AT3G60540 Preprotein translocase Sec, Se... Potri.002G143100 1.41 0.9192
AT1G15120 Ubiquinol-cytochrome C reducta... Potri.002G069200 3.46 0.8834
AT5G07960 unknown protein Potri.015G056300 3.87 0.9004
AT1G11890 ATSEC22, SEC22 SECRETION 22, Synaptobrevin fa... Potri.001G165600 4.89 0.9004 Pt-SEC22.1
AT4G02620 vacuolar ATPase subunit F fami... Potri.005G217600 8.94 0.8957 VATF.1
AT5G20090 Uncharacterised protein family... Potri.012G095133 10.67 0.8611
AT2G24765 ARF3, ARL1, ATA... ARF-LIKE 1, ADP-ribosylation f... Potri.006G171500 11.00 0.8782
AT1G16810 unknown protein Potri.010G253400 12.00 0.8304
AT3G58130 N-acetylglucosaminylphosphatid... Potri.012G041700 14.28 0.8752
AT5G54750 Transport protein particle (TR... Potri.001G418400 17.34 0.8804

Potri.008G053200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.