Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20823 80 / 6e-19 RING/U-box superfamily protein (.1) AT5G05280 79 / 8e-19 RING/U-box superfamily protein (.1) AT3G03550 79 / 1e-17 RING/U-box superfamily protein (.1) AT5G17600 79 / 1e-17 RING/U-box superfamily protein (.1) AT5G57750 76 / 4e-17 RING/U-box superfamily protein (.1) AT4G30400 77 / 7e-17 RING/U-box superfamily protein (.1) AT1G49210 75 / 7e-17 RING/U-box superfamily protein (.1) AT2G17450 74 / 7e-17 RHA3A RING-H2 finger A3A (.1) AT1G49220 75 / 9e-17 RING/U-box superfamily protein (.1) AT4G17905 76 / 1e-16 ATL4H RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G206200 [exp] 177 / 1e-57 AT5G17600 91 / 6e-22 RING/U-box superfamily protein (.1) Potri.006G144200 [exp] 92 / 1e-23 AT5G17600 90 / 3e-21 RING/U-box superfamily protein (.1) Potri.019G043900 [exp] 84 / 6e-20 AT3G03550 223 / 3e-71 RING/U-box superfamily protein (.1) Potri.005G099000 [exp] 81 / 2e-19 AT1G20823 146 / 2e-44 RING/U-box superfamily protein (.1) Potri.002G039700 [exp] 82 / 5e-19 AT5G43420 246 / 4e-79 RING/U-box superfamily protein (.1) Potri.001G235100 [exp] 80 / 6e-19 AT1G04360 98 / 3e-24 RING/U-box superfamily protein (.1) Potri.013G091300 [exp] 80 / 8e-19 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1) Potri.001G309600 [exp] 79 / 1e-18 AT1G49230 261 / 6e-89 RING/U-box superfamily protein (.1) Potri.007G097500 [exp] 81 / 2e-18 AT5G10380 145 / 2e-40 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005954 [exp] 146 / 7e-43 AT3G04020 111 / 7e-28 unknown protein Lus10029456 [exp] 129 / 5e-39 AT5G10380 86 / 3e-21 RING/U-box superfamily protein (.1) Lus10013618 [exp] 83 / 2e-19 AT5G17600 220 / 1e-69 RING/U-box superfamily protein (.1) Lus10024405 [exp] 79 / 1e-18 AT4G17905 95 / 9e-24 RING/U-box superfamily protein (.1) Lus10037264 [exp] 81 / 3e-18 AT3G03550 144 / 3e-40 RING/U-box superfamily protein (.1) Lus10006493 [exp] 80 / 4e-18 AT3G16720 221 / 5e-71 TOXICOS EN LEVADURA 2 (.1) Lus10035677 [exp] 80 / 7e-18 AT3G03550 150 / 5e-42 RING/U-box superfamily protein (.1) Lus10033515 [exp] 78 / 9e-18 AT1G49230 224 / 6e-74 RING/U-box superfamily protein (.1) Lus10025338 [exp] 76 / 9e-18 AT4G17905 99 / 4e-25 RING/U-box superfamily protein (.1) Lus10020859 [exp] 76 / 4e-17 AT1G49230 230 / 3e-76 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.008G054200.1 pacid=42808206 polypeptide=Potri.008G054200.1.p locus=Potri.008G054200 ID=Potri.008G054200.1.v4.1 annot-version=v4.1 ATGTCAGACGACGATAATGATGACCTTAATTCCAAAGTTGCCGTTCTTCTAATTGGGGTTGGAGCAGCAGCTATTGTGGCAACAATTTACCACTGCCTCG TCATGACTTGGTGCTGCCGATACCGGGCCAGGCCTAACCCACAAGAGCCACAACTCCATGTGAACGAAACAATTCTCGAGAATTCTACAGCCCAAGTCAT CCCATCCTATGAGTACCGAAAGGATACAGGCTTGACAGGTGATAATGGAACTTGCGCAATTTGCTTGGGTGATTTTGAAGAAGGAGAGCAACTACGTGAA TTGCCGGAATGCTTGCACTCTTACCATGTGGCATGCATCGATATGTGGCTCTACTCACACTCCAGTTGTCCCATGTGCCGCACCGATGCCAAGCATTCTC AGCAAGTTTTCTCGAATGCAAGGGATTTAGATTCTGAGAGATCATCAGAGCCATACCGAGGTGTAGGTGTATTACGAGGCATTGTTGTGCATCCTCGTGC CATGTAA
AA sequence Show only first row Show all	>Potri.008G054200.1 pacid=42808206 polypeptide=Potri.008G054200.1.p locus=Potri.008G054200 ID=Potri.008G054200.1.v4.1 annot-version=v4.1 MSDDDNDDLNSKVAVLLIGVGAAAIVATIYHCLVMTWCCRYRARPNPQEPQLHVNETILENSTAQVIPSYEYRKDTGLTGDNGTCAICLGDFEEGEQLRE LPECLHSYHVACIDMWLYSHSSCPMCRTDAKHSQQVFSNARDLDSERSSEPYRGVGVLRGIVVHPRAM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G20823			RING/U-box superfamily protein...		Potri.008G054200 [exp]	0	1
					Potri.006G021800 [exp]	3.00	0.8691
AT3G62020		GLP10	germin-like protein 10 (.1.2)		Potri.010G240600 [exp]	6.00	0.8309	Pt-GER2.19
AT1G78955		CAMS1	camelliol C synthase 1 (.1)		Potri.004G132500 [exp]	7.21	0.8396	LCOSC2.4
					Potri.019G017302 [exp]	8.83	0.7985
AT5G40780		LHT1, LTH1	lysine histidine transporter 1...		Potri.001G335200 [exp]	19.39	0.8217
AT1G10040			alpha/beta-Hydrolases superfam...		Potri.002G113000 [exp]	36.94	0.7598
AT2G23140			RING/U-box superfamily protein...		Potri.006G251000 [exp]	68.23	0.7074
AT3G51550		FER	FERONIA, Malectin/receptor-lik...		Potri.016G138700 [exp]	108.47	0.6847
AT3G58710	WRKY	ATWRKY69, WRKY6...	RABIDOPSIS THALIANA WRKY DNA-B...		Potri.014G119800 [exp]	111.64	0.7205
AT5G19650	OFP	ATOFP8, OFP8	ovate family protein 8 (.1)		Potri.002G262500 [exp]	118.99	0.7342

Compare expression of checked genes

Potri.008G054200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.