Potri.008G057600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G02220 57 / 1e-12 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G201900 102 / 6e-31 AT5G02220 59 / 1e-13 unknown protein
Potri.016G100000 46 / 2e-08 AT5G02220 39 / 1e-05 unknown protein
Potri.009G034001 42 / 7e-07 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001570 44 / 1e-07 AT5G02220 57 / 2e-12 unknown protein
PFAM info
Representative CDS sequence
>Potri.008G057600.1 pacid=42806778 polypeptide=Potri.008G057600.1.p locus=Potri.008G057600 ID=Potri.008G057600.1.v4.1 annot-version=v4.1
ATGGAAGTTGATGAAGGATGCAGGACGCCAAGACGCAGCGAATATCAGATACCGGCACCTTTGGTGTGCCCGCCACCACCAAAGAAGAAACCCTTTTATG
TTAAGCAAAGAAGGGTCCCTCCAAAGGAAGGATACTTTCAGCCTCCTGATCTTGAGGGAGTCTTAATGGATATTGCACCAAGAAGGGAAGCTTGTGCTTG
A
AA sequence
>Potri.008G057600.1 pacid=42806778 polypeptide=Potri.008G057600.1.p locus=Potri.008G057600 ID=Potri.008G057600.1.v4.1 annot-version=v4.1
MEVDEGCRTPRRSEYQIPAPLVCPPPPKKKPFYVKQRRVPPKEGYFQPPDLEGVLMDIAPRREACA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G02220 unknown protein Potri.008G057600 0 1
Potri.001G443150 1.00 0.8213
AT5G04250 Cysteine proteinases superfami... Potri.010G225400 1.41 0.8164
AT1G78070 Transducin/WD40 repeat-like su... Potri.002G094100 3.46 0.7830
AT1G53540 HSP20-like chaperones superfam... Potri.010G175200 14.17 0.8040 Pt-HSP17.8
AT5G07330 unknown protein Potri.012G111000 25.29 0.7974
AT2G18260 ATSYP112, SYP11... syntaxin of plants 112 (.1) Potri.007G023100 26.38 0.6075
AT3G18380 SHH2 SAWADEE homeodomain homolog 2,... Potri.011G097500 27.49 0.6827
AT1G73730 EIL AtEIL3, ATSLIM,... ARABIDOPSIS THALIANA SULFUR LI... Potri.001G015966 27.92 0.6867
AT5G59740 UDP-N-acetylglucosamine (UAA) ... Potri.001G234800 30.88 0.6359
AT1G61340 F-box family protein (.1.2) Potri.004G034400 37.66 0.7156

Potri.008G057600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.