Potri.008G060400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G11397 266 / 4e-91 PRA1.A3 prenylated RAB acceptor 1.A3 (.1)
AT5G05987 266 / 4e-91 PRA1.A2 prenylated RAB acceptor 1.A2 (.1)
AT5G02040 255 / 6e-87 PRA1.A1 prenylated RAB acceptor 1.A1 (.1.2)
AT3G11402 266 / 9e-84 Cysteine/Histidine-rich C1 domain family protein (.1.2)
AT5G01640 41 / 0.0003 PRA1.B5 prenylated RAB acceptor 1.B5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G198000 328 / 7e-116 AT5G05987 253 / 3e-86 prenylated RAB acceptor 1.A2 (.1)
Potri.006G091300 279 / 3e-96 AT5G02040 320 / 1e-112 prenylated RAB acceptor 1.A1 (.1.2)
Potri.005G219100 41 / 0.0003 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030160 299 / 3e-104 AT5G05987 308 / 1e-107 prenylated RAB acceptor 1.A2 (.1)
Lus10001021 291 / 7e-101 AT5G05987 301 / 1e-104 prenylated RAB acceptor 1.A2 (.1)
Lus10022592 271 / 2e-93 AT5G02040 298 / 9e-104 prenylated RAB acceptor 1.A1 (.1.2)
Lus10021492 271 / 3e-93 AT5G02040 297 / 1e-103 prenylated RAB acceptor 1.A1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03208 PRA1 PRA1 family protein
Representative CDS sequence
>Potri.008G060400.1 pacid=42806651 polypeptide=Potri.008G060400.1.p locus=Potri.008G060400 ID=Potri.008G060400.1.v4.1 annot-version=v4.1
ATGGATTGGGGAAACGTAACAGCAGAAGATCTAATCGGTGCATTAAAGGAAGTAGATTGGACATCTCCGCCTCGTCCTCTTAATGAATTCTTCTCCAGAT
TCACCATTCCTCGTTCTTACTCGAAGTGGAGTAGCCGCCTCAAATGCAATTCCTACTACTATCGGACAAATTACTTCATTTTGATACTGCTTATTCTTGG
TGTTGCATGTATCTTAAGGCCACTGGCTATTCTAGCCACTGCGTTGTCGGCTCTAAGCATCGCTTTCCTTAATGATAGTTTTGCAGCTACTTTCAGTGAG
AGAGTAACAAGAACTGTAAGGAAGTTCTCTCCACATTTGGCAGCAAAAATGAGGCCTCGGCATATGCCTGTTATCCGTGGTCGTCCATCAGCAAAAAAGT
CTGTGTACATTCTTGGCCAACCTCGTTTATTGTTTGTCCTTTTATTCTCAGCTGTCAGTTTTGTTTTGTGGTATGCTTCTGGCAGTCTTTTGTATATTTC
ATGGGCGCTCATAAGTGGCCTTCTTGTCATTGTGCTCCATGCAAGCTTCAAAACACCTAATCTGAAAGCACGCCTCAACACATTCCGTGAAGAATTTCGT
GCAGTCTGGCGTAATTATAGTGATCTCTAA
AA sequence
>Potri.008G060400.1 pacid=42806651 polypeptide=Potri.008G060400.1.p locus=Potri.008G060400 ID=Potri.008G060400.1.v4.1 annot-version=v4.1
MDWGNVTAEDLIGALKEVDWTSPPRPLNEFFSRFTIPRSYSKWSSRLKCNSYYYRTNYFILILLILGVACILRPLAILATALSALSIAFLNDSFAATFSE
RVTRTVRKFSPHLAAKMRPRHMPVIRGRPSAKKSVYILGQPRLLFVLLFSAVSFVLWYASGSLLYISWALISGLLVIVLHASFKTPNLKARLNTFREEFR
AVWRNYSDL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G11397 PRA1.A3 prenylated RAB acceptor 1.A3 (... Potri.008G060400 0 1
AT5G64560 MRS2-2, ATMGT9 magnesium transporter 9 (.1.2) Potri.008G161400 2.82 0.7253
AT4G11740 SAY1 Ubiquitin-like superfamily pro... Potri.003G122300 3.31 0.7542
AT1G60900 U2 snRNP auxilliary factor, la... Potri.011G050400 3.74 0.6938
AT5G01960 RING/U-box superfamily protein... Potri.016G141200 4.24 0.6992
AT5G64500 Major facilitator superfamily ... Potri.001G286600 4.89 0.7019
AT4G35300 TMT2 tonoplast monosaccharide trans... Potri.004G207100 6.63 0.7469
AT2G36310 NSH1, URH1 nucleoside hydrolase 1, uridin... Potri.006G083400 9.21 0.7173
AT4G33270 AtCDC20.1, CDC2... cell division cycle 20.1, Tran... Potri.015G110300 13.92 0.5760
AT3G58530 RNI-like superfamily protein (... Potri.006G195800 14.42 0.6096
AT4G17670 Protein of unknown function (D... Potri.001G148700 17.83 0.7071

Potri.008G060400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.