Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RAB11.9
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07410 366 / 1e-130 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT3G46830 346 / 1e-122 ATRAB-A2C, AtRab11A, AtRABA2c ARABIDOPSIS RAB GTPASE HOMOLOG A2C, RAB GTPase homolog A2C (.1) AT5G59150 342 / 4e-121 ATRAB-A2D, AtRABA2d ARABIDOPSIS RAB GTPASE HOMOLOG A2D, RAB GTPase homolog A2D (.1) AT1G09630 337 / 7e-119 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) AT5G60860 305 / 3e-106 AtRABA1f RAB GTPase homolog A1F (.1) AT1G16920 301 / 5e-105 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT5G45750 300 / 2e-104 AtRABA1c RAB GTPase homolog A1C (.1) AT4G18430 297 / 2e-103 AtRABA1e RAB GTPase homolog A1E (.1) AT3G15060 297 / 2e-103 AtRABA1g RAB GTPase homolog A1G (.1) AT4G18800 296 / 9e-103 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G197200 [exp] 422 / 9e-153 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.006G000300 [exp] 373 / 2e-133 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.016G000400 [exp] 353 / 1e-125 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.003G004100 [exp] 340 / 2e-120 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.011G061300 [exp] 302 / 3e-105 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1) Potri.011G070300 [exp] 301 / 6e-105 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.001G374000 [exp] 301 / 7e-105 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1) Potri.013G123600 [exp] 299 / 6e-104 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.019G092500 [exp] 297 / 2e-103 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001026 [exp] 404 / 2e-145 AT1G07410 366 / 2e-130 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10004687 [exp] 389 / 2e-139 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10040255 [exp] 389 / 2e-139 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10016486 [exp] 362 / 7e-129 AT1G07410 396 / 1e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10040745 [exp] 360 / 4e-128 AT1G07410 394 / 7e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10041116 [exp] 320 / 3e-112 AT1G09630 395 / 4e-142 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Lus10015297 [exp] 304 / 7e-106 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1) Lus10002178 [exp] 302 / 4e-105 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1) Lus10025432 [exp] 302 / 5e-105 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1) Lus10013961 [exp] 301 / 7e-105 AT5G60860 412 / 7e-149 RAB GTPase homolog A1F (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.008G061300.1 pacid=42806215 polypeptide=Potri.008G061300.1.p locus=Potri.008G061300 ID=Potri.008G061300.1.v4.1 annot-version=v4.1 ATGGCATACAAGGTGGATCATGAATACGATTATTTGTTCAAGATTGTGTTGATTGGAGATTCAGGTGTTGGAAAATCCAACATTCTTTCCAGATTTACTC GTAATGAATTCTGCTTGGAGTCCAAGTCTACTATTGGTGTTGAGTTTGCTACGAGGACTCTTCAGGTAGAAGGGAAGACAGTGAAGGCACAAATATGGGA CACAGCTGGCCAAGAAAGGTACAGAGCTATCACCAGTGCATACTACAGAGGTGCAGTTGGTGCCCTTTTGGTTTATGATATAACCAAGAGGCAAACATTT GATAATGTACAGAGGTGGCTTCGTGAGCTAAGGGATCATGCAGACTCTAACATTGTCATCATGCTGGCTGGAAACAAAACTGATCTGAACCATCTCAGAT CAGTCTCAGCAGAAGATGCTCAAATGCTGGCCGAGAAGGAATGCCTTTCATGTCTTGAGACTTCAGCTTTGGAAGCTTCCAATGTTGAAAAGGCATTCCA GACCATTTTGTTGGATATCTACCAAATTATTAGCAAAAAGGCACTGGCAGCACAAGAGGCAGCTAACTCGACAGGACTTCCCCAGGGGACTACTATTAAT ATTGGAAATTTGTCGACGAATATCAACAAGAAAGCTTGTTGTTCTAACTAA
AA sequence Show only first row Show all	>Potri.008G061300.1 pacid=42806215 polypeptide=Potri.008G061300.1.p locus=Potri.008G061300 ID=Potri.008G061300.1.v4.1 annot-version=v4.1 MAYKVDHEYDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQTF DNVQRWLRELRDHADSNIVIMLAGNKTDLNHLRSVSAEDAQMLAEKECLSCLETSALEASNVEKAFQTILLDIYQIISKKALAAQEAANSTGLPQGTTIN IGNLSTNINKKACCSN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G07410		ATRAB-A2B, AtRA...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Potri.008G061300 [exp]	0	1	RAB11.9
AT2G01818			PLATZ transcription factor fam...		Potri.008G137300 [exp]	2.00	0.8957
AT1G52190			Major facilitator superfamily ...		Potri.001G185700 [exp]	5.47	0.8690
AT5G19160		TBL11	TRICHOME BIREFRINGENCE-LIKE 11...		Potri.008G203900 [exp]	6.00	0.8829
AT3G06130			Heavy metal transport/detoxifi...		Potri.008G202800 [exp]	6.92	0.8482
AT3G13980			unknown protein		Potri.006G144700 [exp]	9.48	0.8524
					Potri.005G038600 [exp]	15.00	0.8367
AT1G52630			O-fucosyltransferase family pr...		Potri.001G171500 [exp]	15.29	0.8319
AT2G03500	GARP		Homeodomain-like superfamily p...		Potri.004G144800 [exp]	16.12	0.7942
AT3G09780		CCR1, ATCRR1	CRINKLY4 related 1 (.1)		Potri.016G089200 [exp]	16.49	0.8351
AT1G78430		RIP2	ROP interactive partner 2 (.1)		Potri.001G377900 [exp]	17.54	0.8625

Compare expression of checked genes

Potri.008G061300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.