Potri.008G063900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32870 80 / 2e-19 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT2G25770 77 / 4e-18 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G193200 181 / 6e-60 AT2G25770 59 / 4e-12 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.018G046100 78 / 2e-18 AT2G25770 188 / 1e-61 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.006G237100 64 / 6e-13 AT4G32870 178 / 8e-58 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G237000 62 / 2e-12 AT4G32870 180 / 9e-59 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G236800 60 / 3e-11 AT4G32870 179 / 1e-57 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028262 234 / 4e-80 AT2G25770 75 / 2e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10040227 235 / 7e-80 AT2G25770 75 / 6e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10005477 76 / 8e-18 AT2G25770 172 / 2e-55 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10006042 64 / 5e-13 AT4G32870 145 / 3e-45 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10000573 56 / 5e-10 AT4G32870 144 / 1e-44 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10026898 50 / 3e-08 AT2G25770 128 / 2e-38 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence
>Potri.008G063900.3 pacid=42807515 polypeptide=Potri.008G063900.3.p locus=Potri.008G063900 ID=Potri.008G063900.3.v4.1 annot-version=v4.1
ATGGAGGTCGAAGCAGGAGTGGTGAAATGGCGTGGATCGGTTGGAGGCATAGTTGATGCACCTATAGACAAAGTCTGGACAATGGTTTCTCAAACCAAGA
AGCTAGCAGAATGGATGCCAATGGTGGAAAGATGCACTGACTTGGTTGGAGAAGAAGGTGTTCCAGGTTATGTTCGGTTAGTGTCAGGATTCATGTTCCC
TCAACAAGATGGTGACAGATCATGGATCAAGGAGAGGTTGGTTTCTCTGGATTCTACATCACACAACTATGTTTACAAAATGGAAGCCAGCAATGTCGGT
TTGGATGGATCAATAAATACATTAAAACTTGTTGATTATTGGGATGATTCCACACTAGTTAACTGGTCATTTCAGATAGACCCTTTGGAAGGCGCCTCCG
AGGATAGCATAATAGATTATCTAGGATTTCTGTATAAATCTGGCATTAACAGGATTGAAGGTGCTATAAAAGCTTCATCGATAGGAGTTTGA
AA sequence
>Potri.008G063900.3 pacid=42807515 polypeptide=Potri.008G063900.3.p locus=Potri.008G063900 ID=Potri.008G063900.3.v4.1 annot-version=v4.1
MEVEAGVVKWRGSVGGIVDAPIDKVWTMVSQTKKLAEWMPMVERCTDLVGEEGVPGYVRLVSGFMFPQQDGDRSWIKERLVSLDSTSHNYVYKMEASNVG
LDGSINTLKLVDYWDDSTLVNWSFQIDPLEGASEDSIIDYLGFLYKSGINRIEGAIKASSIGV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G32870 Polyketide cyclase/dehydrase a... Potri.008G063900 0 1
AT5G17990 PAT1, TRP1 PHOSPHORIBOSYLANTHRANILATE TRA... Potri.012G082700 4.00 0.8422
AT1G55580 GRAS SCL18, LAS SCARECROW-LIKE 18, Lateral Sup... Potri.015G008300 5.47 0.8826
AT5G66160 JR700, ATRMR1 ARABIDOPSIS THALIANA RECEPTOR ... Potri.005G111100 10.58 0.8722
AT4G30310 FGGY family of carbohydrate ki... Potri.018G095700 11.22 0.7810
AT5G18910 Protein kinase superfamily pro... Potri.010G027301 15.90 0.8551
AT1G13680 PLC-like phosphodiesterases su... Potri.004G117500 16.00 0.8687
AT1G67370 ASY1, ATASY1 ASYNAPTIC 1, DNA-binding HORMA... Potri.001G055201 16.06 0.8663
AT2G16230 O-Glycosyl hydrolases family 1... Potri.014G184900 18.54 0.8588
AT1G55580 GRAS SCL18, LAS SCARECROW-LIKE 18, Lateral Sup... Potri.001G473200 20.34 0.8584
AT2G16230 O-Glycosyl hydrolases family 1... Potri.014G184300 21.21 0.8424

Potri.008G063900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.