ELF4.1 (Potri.008G068200) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol ELF4.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G40080 112 / 3e-33 ELF4 EARLY FLOWERING 4, Protein of unknown function (DUF1313) (.1)
AT2G29950 96 / 1e-26 ELF4-L1 ELF4-like 1 (.1)
AT2G06255 86 / 1e-22 ELF4-L3 ELF4-like 3 (.1)
AT1G17455 80 / 2e-20 ELF4-L4 ELF4-like 4 (.1.2)
AT1G72630 75 / 2e-18 ELF4-L2 ELF4-like 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G251600 109 / 6e-32 AT2G29950 109 / 6e-32 ELF4-like 1 (.1)
Potri.009G046400 106 / 1e-30 AT2G29950 99 / 6e-28 ELF4-like 1 (.1)
Potri.003G063900 92 / 2e-25 AT1G17455 156 / 7e-51 ELF4-like 4 (.1.2)
Potri.001G170100 91 / 9e-25 AT1G17455 158 / 1e-51 ELF4-like 4 (.1.2)
Potri.006G143800 87 / 4e-23 AT1G17455 166 / 1e-54 ELF4-like 4 (.1.2)
Potri.019G131700 81 / 1e-20 AT2G06255 107 / 2e-31 ELF4-like 3 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040667 105 / 4e-30 AT2G29950 108 / 4e-31 ELF4-like 1 (.1)
Lus10028288 100 / 1e-28 AT2G40080 110 / 1e-32 EARLY FLOWERING 4, Protein of unknown function (DUF1313) (.1)
Lus10018237 98 / 4e-27 AT2G29950 112 / 6e-33 ELF4-like 1 (.1)
Lus10000371 89 / 1e-23 AT1G17455 140 / 2e-44 ELF4-like 4 (.1.2)
Lus10000408 88 / 2e-23 AT1G17455 148 / 1e-47 ELF4-like 4 (.1.2)
Lus10001250 88 / 2e-23 AT1G17455 148 / 1e-47 ELF4-like 4 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07011 Elf4 Early Flowering 4 domain
Representative CDS sequence
>Potri.008G068200.1 pacid=42807964 polypeptide=Potri.008G068200.1.p locus=Potri.008G068200 ID=Potri.008G068200.1.v4.1 annot-version=v4.1
ATGAACACCACCCTCGATTCATTCTCCGCTGCCGAATCGAGCATGGAAGACACCTCCAATCCCTCAATCACTACCAACCAAAACGCCAACAAAGAAGATG
AAGTTGATGCAGAGGTTTGGGCAACATTCAACAATAGTTTTCGACAAGTTCAGTCGGTTCTGGACAGAAACAGAGTTTTGATTCAACAAGTGAATGAGAA
TCACCAGTCTAGAACTCCTGACAACATGGTCAAAAACGTCTCTCTGATTCAAGAACTTAACGGCAATATCTCCAAGGTTGTTGGGCTTTACTCTGATTTG
AATTCCAATTTCTCCACTGCTTATCATCAGCGAAACCACAACGGTAAAAATAACGGCAAGAAGGCCTGA
AA sequence
>Potri.008G068200.1 pacid=42807964 polypeptide=Potri.008G068200.1.p locus=Potri.008G068200 ID=Potri.008G068200.1.v4.1 annot-version=v4.1
MNTTLDSFSAAESSMEDTSNPSITTNQNANKEDEVDAEVWATFNNSFRQVQSVLDRNRVLIQQVNENHQSRTPDNMVKNVSLIQELNGNISKVVGLYSDL
NSNFSTAYHQRNHNGKNNGKKA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G40080 ELF4 EARLY FLOWERING 4, Protein of ... Potri.008G068200 0 1 ELF4.1
AT3G14630 CYP72A9 "cytochrome P450, family 72, s... Potri.011G099701 4.24 0.7168
AT5G61340 unknown protein Potri.004G102800 14.07 0.6576
AT2G39650 Protein of unknown function (D... Potri.010G203700 24.49 0.6172
AT2G33255 Haloacid dehalogenase-like hyd... Potri.010G063700 30.00 0.6522
AT3G14660 CYP72A13 "cytochrome P450, family 72, s... Potri.011G099200 56.92 0.6438
AT1G56300 Chaperone DnaJ-domain superfam... Potri.005G020300 58.14 0.6398
AT3G29270 RING/U-box superfamily protein... Potri.012G067200 67.83 0.5956
AT1G56300 Chaperone DnaJ-domain superfam... Potri.013G010800 68.05 0.5746
AT2G42520 P-loop containing nucleoside t... Potri.003G217800 71.13 0.5967
AT3G14690 CYP72A15 "cytochrome P450, family 72, s... Potri.011G101250 74.09 0.5768

Potri.008G068200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.