Potri.008G069050 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.008G069050.1 pacid=42808134 polypeptide=Potri.008G069050.1.p locus=Potri.008G069050 ID=Potri.008G069050.1.v4.1 annot-version=v4.1
ATGGTCTTGGTGGAGGCCAAAAGCACTACAGGACATGTGTATACCAAATATGGCAACGAACATACAAGTGGCCGGGAGATGCTTCCACAATTATGTGTAC
GATGGGGAATATTGGCGGTTTGCTTCTACTATGGCCTCAACTATGCAAGATGGTTTGATTTGAGTGGCCTCCTAATTCTGGCAAGTGGGGTTTTCCAGTC
AGAGCCCTTTGAAATCAATGGTGCTGGGGTCTTGTCTTTGGTCCTCCGCTATCTGCTTACACTCCATCCAGTGAAGAAATTAGTGTCCTGTCAACCACCA
TAG
AA sequence
>Potri.008G069050.1 pacid=42808134 polypeptide=Potri.008G069050.1.p locus=Potri.008G069050 ID=Potri.008G069050.1.v4.1 annot-version=v4.1
MVLVEAKSTTGHVYTKYGNEHTSGREMLPQLCVRWGILAVCFYYGLNYARWFDLSGLLILASGVFQSEPFEINGAGVLSLVLRYLLTLHPVKKLVSCQPP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.008G069050 0 1
Potri.019G014330 1.00 0.9916
Potri.006G195500 3.00 0.9804
AT3G23770 O-Glycosyl hydrolases family 1... Potri.001G321900 3.16 0.9772 A6.1
AT1G67950 RNA-binding (RRM/RBD/RNP motif... Potri.010G103600 7.48 0.9723
Potri.005G031948 9.53 0.9760
AT5G05800 unknown protein Potri.010G045701 10.81 0.9760
Potri.002G132850 14.49 0.9720
AT2G19080 metaxin-related (.1) Potri.018G145080 14.56 0.9231
Potri.001G004432 15.90 0.9559
AT2G25737 Sulfite exporter TauE/SafE fam... Potri.018G037400 16.09 0.9417

Potri.008G069050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.