Potri.008G069300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05600 528 / 0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G11180 506 / 1e-180 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT3G55970 504 / 3e-180 ATJRG21 jasmonate-regulated gene 21 (.1)
AT2G38240 438 / 2e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G22880 247 / 1e-79 TT18, TDS4, ANS, LDOX TANNIN DEFICIENT SEED 4, ANTHOCYANIDIN SYNTHASE, leucoanthocyanidin dioxygenase (.1.2)
AT3G21420 239 / 2e-76 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G17020 236 / 5e-75 ATSRG1, SRG1 senescence-related gene 1 (.1)
AT4G25300 234 / 2e-74 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT4G10490 232 / 1e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G10500 229 / 2e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G188000 669 / 0 AT5G05600 511 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.016G117100 517 / 0 AT5G05600 491 / 4e-175 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G101200 503 / 7e-180 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G101100 496 / 3e-177 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G024100 247 / 3e-79 AT4G16330 419 / 7e-147 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.003G119100 246 / 9e-79 AT4G22880 530 / 0.0 TANNIN DEFICIENT SEED 4, ANTHOCYANIDIN SYNTHASE, leucoanthocyanidin dioxygenase (.1.2)
Potri.001G355100 242 / 2e-77 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1)
Potri.001G113100 240 / 8e-77 AT4G22880 530 / 0.0 TANNIN DEFICIENT SEED 4, ANTHOCYANIDIN SYNTHASE, leucoanthocyanidin dioxygenase (.1.2)
Potri.001G382400 240 / 9e-77 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004387 520 / 0 AT3G11180 509 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10005037 483 / 1e-171 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10004808 477 / 8e-170 AT5G05600 457 / 5e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027807 345 / 1e-118 AT5G05600 330 / 1e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10040112 244 / 3e-78 AT1G17020 332 / 1e-112 senescence-related gene 1 (.1)
Lus10030995 244 / 6e-78 AT1G17020 339 / 2e-115 senescence-related gene 1 (.1)
Lus10037292 244 / 1e-77 AT4G16330 416 / 5e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10028068 242 / 1e-77 AT5G08640 429 / 1e-151 flavonol synthase 1 (.1.2)
Lus10030934 240 / 2e-76 AT1G17020 337 / 2e-114 senescence-related gene 1 (.1)
Lus10030185 239 / 2e-76 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
CL0029 Cupin PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence
>Potri.008G069300.1 pacid=42806166 polypeptide=Potri.008G069300.1.p locus=Potri.008G069300 ID=Potri.008G069300.1.v4.1 annot-version=v4.1
ATGAATAAGCTCTTAGATTGGCCCGAACCAATAGTTCGTGTACAATCCTTGTCCGACAGCGGCACACCCCTGATTCCTGAGCGATATGTCAAGCCCCCGC
TAGAGAGGCCATCCATAAATTCCACTGCTTCAATGGATGTGAACATCCCTGTTATTGATCTTGTCGGACTGTACGGTGATGATCATGCCCTCCGTGCCGC
TATACTTGACCAAATTTCTATAGCATGCCGGGAGTGGGGATTTTTTCAAGTGATTAACCATGGTGTTAGCCCTCAATTGATGGACCGTGCCCGAGAAGCA
TGGAGGCAGTTCTTTCATTCGCCCATGGAGGTTAAGCAAGCTTATGCAAACACACCCAAGACTTATGAAGGTTATGGTAGCCGGTTAGGGGTTGAAAAGG
GTGCCATACTTGATTGGAGTGATTACTACTTCCTCCACTATCTTCCTTCAACATTGAAGGACTGTAGCAAATGGCCTACCATTCCAGCTGATTGCAGGGA
AGTGCTTGATGAATATGGCAAGCAATTGGTGAAGCTATGTGGGAGGTTAATGAAGATTTTATCAATAAACCTTGGATTAGGAGAGGAACGACTTCAAAAT
GCATTTGGCGGCGAAAATATTGGGGCATGCCTCAGAGTTAATTTTTACCCCAAGTGTCCACAGCCTGACCTGGCCCTTGGTTTATCATCGCATTCGGATC
CCGGTGGCATAACCCTTCTCTTGCCAGACAATCATGTCCCTGGTCTTCAGGTTCGTAAGGATGAGAATTGGATTACTGTAAAACCAGCTCCACATGCTTT
TATTGTTAATATTGGTGATCAAATTCAGGTGCTAAGCAATGCAACTTACAAGAGTGTGGAGCATAGAGTGATAGTAAATTCATCGAAAGAGCGTGTCTCT
CTTGCTTTCTTCTACAATCCAAAGAGTGATATACCCATAGAGCCATTGAAGGAGCTTCTGGCGCCTGACAGACCTCCACTCTATCCAGCGATGACATTTG
ATGAATACAGACTCTTCATAAGAATGAGAGGTCCCAGTGGCAAATCCCAAGTGGAGTCTCTAAAATCTCCGAGATGA
AA sequence
>Potri.008G069300.1 pacid=42806166 polypeptide=Potri.008G069300.1.p locus=Potri.008G069300 ID=Potri.008G069300.1.v4.1 annot-version=v4.1
MNKLLDWPEPIVRVQSLSDSGTPLIPERYVKPPLERPSINSTASMDVNIPVIDLVGLYGDDHALRAAILDQISIACREWGFFQVINHGVSPQLMDRAREA
WRQFFHSPMEVKQAYANTPKTYEGYGSRLGVEKGAILDWSDYYFLHYLPSTLKDCSKWPTIPADCREVLDEYGKQLVKLCGRLMKILSINLGLGEERLQN
AFGGENIGACLRVNFYPKCPQPDLALGLSSHSDPGGITLLLPDNHVPGLQVRKDENWITVKPAPHAFIVNIGDQIQVLSNATYKSVEHRVIVNSSKERVS
LAFFYNPKSDIPIEPLKELLAPDRPPLYPAMTFDEYRLFIRMRGPSGKSQVESLKSPR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G05600 2-oxoglutarate (2OG) and Fe(II... Potri.008G069300 0 1
AT2G26560 PLP2, PLAIIA, P... PATATIN-LIKE PROTEIN 2, phosph... Potri.017G134200 2.82 0.8942
AT3G14470 NB-ARC domain-containing disea... Potri.001G022800 6.32 0.8424
AT4G21920 unknown protein Potri.004G015900 7.54 0.8707
AT3G16030 CES101 CALLUS EXPRESSION OF RBCS 101,... Potri.001G441400 8.24 0.8622
AT4G08170 Inositol 1,3,4-trisphosphate 5... Potri.009G084600 9.16 0.8230
AT5G36930 Disease resistance protein (TI... Potri.019G019710 13.85 0.8297
AT5G36930 Disease resistance protein (TI... Potri.019G019053 14.89 0.8520
AT5G13220 ZIM JAS1, TIFY9, JA... TIFY DOMAIN PROTEIN 9, JASMONA... Potri.001G062500 17.74 0.8620
AT5G65280 GCL1 GCR2-like 1 (.1) Potri.007G096500 18.11 0.8464
AT4G05100 MYB ATMYB74 myb domain protein 74 (.1) Potri.019G118200 22.13 0.8513

Potri.008G069300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.