Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11110 122 / 4e-36 RING/U-box superfamily protein (.1) AT2G42360 89 / 5e-22 RING/U-box superfamily protein (.1) AT4G09100 80 / 9e-20 RING/U-box superfamily protein (.1) AT3G10910 79 / 1e-18 RING/U-box superfamily protein (.1) AT4G15975 78 / 5e-18 RING/U-box superfamily protein (.1) AT2G42350 77 / 8e-18 RING/U-box superfamily protein (.1) AT1G23980 79 / 9e-18 RING/U-box superfamily protein (.1) AT3G18930 79 / 1e-17 RING/U-box superfamily protein (.1.2) AT5G43420 79 / 2e-17 RING/U-box superfamily protein (.1) AT3G16720 78 / 2e-17 ATL2 TOXICOS EN LEVADURA 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G136200 [exp] 80 / 3e-19 AT3G10910 144 / 8e-44 RING/U-box superfamily protein (.1) Potri.013G091300 [exp] 80 / 4e-19 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1) Potri.013G157000 [exp] 79 / 6e-19 AT3G10910 114 / 1e-32 RING/U-box superfamily protein (.1) Potri.009G110000 [exp] 81 / 2e-18 AT3G18930 227 / 5e-70 RING/U-box superfamily protein (.1.2) Potri.019G091400 [exp] 79 / 4e-18 AT2G42360 143 / 9e-42 RING/U-box superfamily protein (.1) Potri.001G159300 [exp] 77 / 5e-18 AT5G05280 134 / 3e-40 RING/U-box superfamily protein (.1) Potri.008G165900 [exp] 79 / 6e-18 AT1G04360 312 / 2e-104 RING/U-box superfamily protein (.1) Potri.018G085001 [exp] 79 / 9e-18 AT4G28890 290 / 2e-94 RING/U-box superfamily protein (.1) Potri.002G039700 [exp] 79 / 1e-17 AT5G43420 246 / 4e-79 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040942 [exp] 130 / 1e-38 AT3G11110 109 / 1e-30 RING/U-box superfamily protein (.1) Lus10009832 [exp] 124 / 2e-36 AT3G11110 104 / 7e-29 RING/U-box superfamily protein (.1) Lus10022743 [exp] 84 / 1e-20 AT3G10910 154 / 5e-48 RING/U-box superfamily protein (.1) Lus10011702 [exp] 84 / 2e-19 AT4G28890 231 / 1e-71 RING/U-box superfamily protein (.1) Lus10036466 [exp] 83 / 4e-19 AT1G72200 186 / 6e-55 RING/U-box superfamily protein (.1) Lus10002194 [exp] 81 / 5e-19 AT2G42360 153 / 4e-46 RING/U-box superfamily protein (.1) Lus10009511 [exp] 82 / 1e-18 AT2G20030 228 / 3e-71 RING/U-box superfamily protein (.1) Lus10016163 [exp] 79 / 1e-18 AT2G27940 133 / 1e-38 RING/U-box superfamily protein (.1) Lus10037264 [exp] 81 / 3e-18 AT3G03550 144 / 3e-40 RING/U-box superfamily protein (.1) Lus10041134 [exp] 80 / 5e-18 AT1G72200 182 / 3e-54 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.008G071000.1 pacid=42808627 polypeptide=Potri.008G071000.1.p locus=Potri.008G071000 ID=Potri.008G071000.1.v4.1 annot-version=v4.1 ATGGCATCACAAGACTCCCAACCATTCCACTGGCACTACGAAGAACTCGACGAAAATGACTTCCAAGTCCGTGGCCGCGCTCTCTTTTATGTACTGATCG TCGGCTCCATGATCATCCTTATCGCCCTACTCTCCATCTACGCCCGCTGGGTCTGCCTTGAAAACACGCGGCATAACCTTCCCTCTAGGCTTCCTGTGCA CCACGCGCCTCGCCTTCCTCCAAGAGGCCTCGAATCCACGATCATCAAGGCTTTGCCGATAACTTTGCACAAATCAAATTTGGGTACCAGTAATAATGGC ACTGCAGTCGAAAGCGAGTGCTGTATATGCCTTGGTGTGTTTGAAGATGGTGATAGGCTGAAAGTTTTGCCGCAGTGTCAGCATTGTTTTCATTGTGACT GCGTCGATAAGTGGCTTGTCACTCAGTCAAGTTGCCCACTCTGTAGAGCTTCTATCCGAGCTGAATCGGCTGTTTTATCGATCATAACAGAGTAA
AA sequence Show only first row Show all	>Potri.008G071000.1 pacid=42808627 polypeptide=Potri.008G071000.1.p locus=Potri.008G071000 ID=Potri.008G071000.1.v4.1 annot-version=v4.1 MASQDSQPFHWHYEELDENDFQVRGRALFYVLIVGSMIILIALLSIYARWVCLENTRHNLPSRLPVHHAPRLPPRGLESTIIKALPITLHKSNLGTSNNG TAVESECCICLGVFEDGDRLKVLPQCQHCFHCDCVDKWLVTQSSCPLCRASIRAESAVLSIITE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G11110			RING/U-box superfamily protein...		Potri.008G071000 [exp]	0	1
AT1G48570			zinc finger (Ran-binding) fami...		Potri.015G038200 [exp]	1.41	0.9368
AT1G07740			Tetratricopeptide repeat (TPR)...		Potri.003G204100 [exp]	3.87	0.9207
AT5G06400			Pentatricopeptide repeat (PPR)...		Potri.006G200800 [exp]	5.09	0.9269
AT3G22670			Pentatricopeptide repeat (PPR)...		Potri.010G083900 [exp]	6.70	0.9148
AT3G53440			Homeodomain-like superfamily p...		Potri.006G280800 [exp]	8.06	0.8536
AT1G33350			Pentatricopeptide repeat (PPR)...		Potri.013G089400 [exp]	8.36	0.9038
AT3G18970		MEF20	mitochondrial editing factor ...		Potri.002G159600 [exp]	8.77	0.8420
AT5G08310			Tetratricopeptide repeat (TPR)...		Potri.005G090600 [exp]	11.66	0.9075
AT1G30010			Intron maturase, type II famil...		Potri.004G132450 [exp]	11.83	0.9162
AT3G14730			Pentatricopeptide repeat (PPR)...		Potri.006G090900 [exp]	12.00	0.9097

Compare expression of checked genes

Potri.008G071000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.