Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56110 213 / 3e-70 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2) AT5G05380 203 / 2e-66 PRA1.B3 prenylated RAB acceptor 1.B3 (.1) AT2G38360 201 / 3e-65 PRA1.B4 prenylated RAB acceptor 1.B4 (.1) AT2G40380 176 / 1e-55 PRA1.B2 prenylated RAB acceptor 1.B2 (.1) AT5G01640 166 / 2e-51 PRA1.B5 prenylated RAB acceptor 1.B5 (.1) AT5G07110 137 / 2e-40 PRA1.B6 prenylated RAB acceptor 1.B6 (.1) AT1G55190 81 / 5e-19 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) AT1G08770 78 / 1e-17 PRA1.E prenylated RAB acceptor 1.E (.1) AT4G00005 74 / 8e-17 PRA1 (Prenylated rab acceptor) family protein (.1) AT3G13720 74 / 4e-16 PRA8, PRA1.F3 PRENYLATED RAB ACCEPTOR 1.F3, PRA1 (Prenylated rab acceptor) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G074000 [exp] 272 / 2e-93 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2) Potri.010G183300 [exp] 240 / 7e-81 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2) Potri.016G126400 [exp] 176 / 2e-55 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1) Potri.006G104400 [exp] 167 / 3e-52 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1) Potri.019G124100 [exp] 149 / 3e-45 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1) Potri.002G044000 [exp] 100 / 1e-26 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.005G219100 [exp] 94 / 7e-24 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.005G054700 [exp] 93 / 3e-23 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1) Potri.002G043800 [exp] 87 / 3e-21 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009842 [exp] 221 / 4e-73 AT2G38360 278 / 1e-95 prenylated RAB acceptor 1.B4 (.1) Lus10007533 [exp] 218 / 4e-72 AT2G38360 281 / 6e-97 prenylated RAB acceptor 1.B4 (.1) Lus10017425 [exp] 218 / 8e-72 AT2G38360 281 / 9e-97 prenylated RAB acceptor 1.B4 (.1) Lus10012224 [exp] 198 / 4e-64 AT2G38360 310 / 3e-108 prenylated RAB acceptor 1.B4 (.1) Lus10002853 [exp] 196 / 5e-63 AT2G38360 305 / 4e-106 prenylated RAB acceptor 1.B4 (.1) Lus10042246 [exp] 177 / 2e-55 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1) Lus10026404 [exp] 167 / 4e-52 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1) Lus10022680 [exp] 132 / 7e-39 AT2G38360 232 / 1e-78 prenylated RAB acceptor 1.B4 (.1) Lus10014234 [exp] 99 / 4e-26 AT2G38360 164 / 1e-51 prenylated RAB acceptor 1.B4 (.1) Lus10021996 [exp] 83 / 2e-19 AT1G08770 162 / 3e-50 prenylated RAB acceptor 1.E (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03208 [poplar] [flax] PRA1 PRA1 family protein
Representative CDS sequence Show only first row Show all	>Potri.008G074033.1 pacid=42806014 polypeptide=Potri.008G074033.1.p locus=Potri.008G074033 ID=Potri.008G074033.1.v4.1 annot-version=v4.1 ATGTCCTCTCCTACAATCCCGATCTCAAATCCCCAAACCCTATCCCAACCCCCGATAGCAACTCCCGCTTTCCGCACTTTCCTCTCTCGCCTCTCCATCT CCATCCGCCAAGGCTTCTCTCAACGCCGCCCATGGTACGAGCTTATAGACCGATCCTCCATGGCCCGACCCGACTCTATCTCCGAAGCCGCAACCCGCAT CCGAAAAAATCTCTCTTATTTCAAAGTCAATTACATAACCTTACTCGCACTTATACTCGCTTTTTCCCTCCTTTCTCACCCCCTCTCCCTCCTCGCCCTT CTATCACTCCTTGCGTCTTGGATTTTCCTCTACCTCTTTCGACCGTCAGATCAGCCTTTGGTTATTCTCGGCCGTACATTCTCGGAACGTGAGACGCTGG GGATTCTTGTTGTTTTGACGATTGTTGTTATTTTCTTGACAAGCGTAGGATCGCTCTTGATCTCCGCTTTGATGGTTGGGTTTGCTCTTGTTTGTGCTCA TGGCGCGTTTAGGGTTCCTGATGATTTGTTTCTTGATGACCAGGAACCTGCTAGTGCTGGTTTCTTGTCTTTCCTTGGCGGCGGCGCCTCTTCCGCCGCT GTTGCGGCTGCTCCTGCTGTTCTCGCTCGTGTTTGA
AA sequence Show only first row Show all	>Potri.008G074033.1 pacid=42806014 polypeptide=Potri.008G074033.1.p locus=Potri.008G074033 ID=Potri.008G074033.1.v4.1 annot-version=v4.1 MSSPTIPISNPQTLSQPPIATPAFRTFLSRLSISIRQGFSQRRPWYELIDRSSMARPDSISEAATRIRKNLSYFKVNYITLLALILAFSLLSHPLSLLAL LSLLASWIFLYLFRPSDQPLVILGRTFSERETLGILVVLTIVVIFLTSVGSLLISALMVGFALVCAHGAFRVPDDLFLDDQEPASAGFLSFLGGGASSAA VAAAPAVLARV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G56110		PRA1.B1	prenylated RAB acceptor 1.B1 (...		Potri.008G074033 [exp]	0	1
AT3G56110		PRA1.B1	prenylated RAB acceptor 1.B1 (...		Potri.008G074000 [exp]	1.00	0.9667
AT4G26000		PEP	PEPPER, RNA-binding KH domain-...		Potri.006G277200 [exp]	2.82	0.8677
AT5G11170			DEAD/DEAH box RNA helicase fam...		Potri.006G253100 [exp]	7.74	0.8468
AT3G26600		ARO4	armadillo repeat only 4 (.1)		Potri.015G082800 [exp]	8.12	0.7838
AT1G80750			Ribosomal protein L30/L7 famil...		Potri.003G180700 [exp]	10.72	0.8275
AT4G03120			C2H2 and C2HC zinc fingers sup...		Potri.003G058400 [exp]	12.48	0.8230
AT2G35470			unknown protein		Potri.001G138300 [exp]	13.41	0.8139
AT5G40190			RNA ligase/cyclic nucleotide p...		Potri.017G073800 [exp]	15.49	0.8101
AT3G26400		EIF4B1	eukaryotic translation initiat...		Potri.010G048200 [exp]	17.43	0.7604	EIF4.3
AT1G61620			phosphoinositide binding (.1)		Potri.004G026800 [exp]	21.49	0.8106

Compare expression of checked genes

Potri.008G074033 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.