Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14270 66 / 2e-14 unknown protein AT2G41430 65 / 1e-13 LSR1, CID1, ERD15 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G182800 [exp] 232 / 7e-80 AT4G14270 65 / 6e-14 unknown protein Potri.006G044600 [exp] 72 / 1e-16 AT2G41430 122 / 3e-36 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Potri.016G041600 [exp] 72 / 1e-16 AT2G41430 121 / 1e-35 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Potri.001G023100 [exp] 69 / 2e-15 AT4G14270 89 / 3e-23 unknown protein Potri.003G202500 [exp] 69 / 3e-15 AT2G41430 81 / 5e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040964 [exp] 136 / 7e-42 AT2G41430 69 / 2e-15 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10009847 [exp] 126 / 4e-38 AT2G41430 63 / 3e-13 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10019769 [exp] 74 / 4e-17 AT2G41430 91 / 1e-23 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10031029 [exp] 69 / 9e-16 AT2G41430 115 / 3e-34 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10016358 [exp] 71 / 1e-15 AT2G41430 83 / 1e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10035419 [exp] 69 / 1e-15 AT2G41430 113 / 2e-33 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10018018 [exp] 62 / 1e-12 AT2G41430 102 / 8e-29 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10042014 [exp] 59 / 8e-12 AT2G41430 99 / 1e-27 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07145 [poplar] [flax] PAM2 Ataxin-2 C-terminal region
Representative CDS sequence Show only first row Show all	>Potri.008G074600.1 pacid=42808042 polypeptide=Potri.008G074600.1.p locus=Potri.008G074600 ID=Potri.008G074600.1.v4.1 annot-version=v4.1 ATGGAGATAATGTCTCACAGATCAGCATCAACATTAAATCCCAACGCTCCGCTATTTGTACCGCTGTCATATCGAACGGTGGAGGATTTTTCCGACCAAT GGTGGGCCCTTGTCCAGTCCTCCCCTTGGTTCCGAGACTACTGGCTCGAAGAACGTTTCTATGATCCCGAATCTGACCCTTCATTCTCTGATATTTACGA TTCTTTCCTCCCCGACGATCTCTACTCTCTCTTCTTCGACGACCCAATTTACGACACTATCAAAGGGGAGGAGGAGGAGGAGGAGGTGAAGGGATGCAAC AAGGAATTGGTTTCGCTTGGAGTGATGAAGTGGAAAAAGGGTCGAGTTGATCGTGCTCAGGCACCGAGGTATTTGGAGAAGGCACCCAAGATAGTGAGTG TGAAGCTGAGTCCAAGGACGATTCAGCAACCGAAGTAG
AA sequence Show only first row Show all	>Potri.008G074600.1 pacid=42808042 polypeptide=Potri.008G074600.1.p locus=Potri.008G074600 ID=Potri.008G074600.1.v4.1 annot-version=v4.1 MEIMSHRSASTLNPNAPLFVPLSYRTVEDFSDQWWALVQSSPWFRDYWLEERFYDPESDPSFSDIYDSFLPDDLYSLFFDDPIYDTIKGEEEEEEVKGCN KELVSLGVMKWKKGRVDRAQAPRYLEKAPKIVSVKLSPRTIQQPK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G14270			unknown protein		Potri.008G074600 [exp]	0	1
AT5G52120		ATPP2-A14	phloem protein 2-A14 (.1)		Potri.012G136200 [exp]	10.00	0.8552
AT1G16000			unknown protein		Potri.004G051201 [exp]	13.19	0.8544
AT1G08530			unknown protein		Potri.019G030400 [exp]	16.24	0.8538
AT1G80920		AtToc12, AtJ8, ...	translocon at the outer envelo...		Potri.001G043100 [exp]	16.70	0.8694	J8.1
AT1G28520	VOZ	ATVOZ1, VOZ1	vascular plant one zinc finger...		Potri.011G060000 [exp]	23.91	0.8262
AT1G60010			unknown protein		Potri.010G095400 [exp]	29.00	0.8250
AT5G56550		ATOXS3	oxidative stress 3 (.1)		Potri.001G190700 [exp]	54.40	0.8337
AT4G23990		ATCSLG3	ARABIDOPSIS THALIANA CELLULOSE...		Potri.003G142500 [exp]	69.11	0.8319
AT2G44970			alpha/beta-Hydrolases superfam...		Potri.018G085600 [exp]	72.66	0.8084
AT3G18430			Calcium-binding EF-hand family...		Potri.003G030300 [exp]	73.56	0.8185

Compare expression of checked genes

Potri.008G074600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.