Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56180 178 / 1e-56 Protein of unknown function (DUF567) (.1) AT3G10986 139 / 9e-42 Protein of unknown function (DUF567) (.1) AT5G01750 119 / 1e-33 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) AT3G11740 118 / 2e-33 Protein of unknown function (DUF567) (.1) AT2G14560 109 / 9e-30 LURP1 LATE UPREGULATED IN RESPONSE TO HYALOPERONOSPORA PARASITICA, Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) AT1G33840 101 / 2e-26 Protein of unknown function (DUF567) (.1) AT3G16900 69 / 1e-14 Protein of unknown function (DUF567) (.1) AT2G38640 53 / 1e-08 Protein of unknown function (DUF567) (.1) AT1G80120 40 / 0.0004 Protein of unknown function (DUF567) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G182300 [exp] 298 / 3e-104 AT3G56180 201 / 5e-66 Protein of unknown function (DUF567) (.1) Potri.016G131850 [exp] 105 / 4e-28 AT5G01750 213 / 3e-70 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) Potri.016G130700 [exp] 104 / 1e-27 AT5G01750 209 / 2e-68 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) Potri.016G130500 [exp] 102 / 4e-27 AT5G01750 218 / 6e-72 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) Potri.016G131800 [exp] 98 / 4e-25 AT5G01750 213 / 3e-70 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) Potri.016G131701 [exp] 94 / 5e-24 AT5G01750 201 / 2e-65 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) Potri.016G130400 [exp] 88 / 2e-21 AT5G01750 181 / 3e-57 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) Potri.016G131100 [exp] 77 / 3e-17 AT5G01750 154 / 3e-47 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) Potri.016G131600 [exp] 76 / 4e-17 AT5G01750 128 / 4e-37 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040968 [exp] 225 / 6e-75 AT3G56180 162 / 2e-50 Protein of unknown function (DUF567) (.1) Lus10022754 [exp] 105 / 6e-28 AT5G01750 214 / 3e-70 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) Lus10014154 [exp] 99 / 9e-26 AT5G01750 206 / 2e-67 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) Lus10002477 [exp] 97 / 1e-24 AT5G01750 218 / 5e-72 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) Lus10001255 [exp] 97 / 1e-24 AT5G01750 218 / 5e-72 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) Lus10014021 [exp] 92 / 5e-23 AT5G01750 202 / 6e-66 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) Lus10009092 [exp] 78 / 1e-17 AT5G01750 161 / 7e-50 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) Lus10025254 [exp] 77 / 2e-17 AT5G01750 166 / 1e-51 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) Lus10025253 [exp] 76 / 5e-17 AT5G01750 169 / 4e-53 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2) Lus10009094 [exp] 72 / 1e-15 AT5G01750 150 / 1e-45 Protein of unknown function (DUF567) (.1), Protein of unknown function (DUF567) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0395 [poplar] [flax] Tubby_C PF04525 [poplar] [flax] LOR LURP-one-related
Representative CDS sequence Show only first row Show all	>Potri.008G075100.1 pacid=42805935 polypeptide=Potri.008G075100.1.p locus=Potri.008G075100 ID=Potri.008G075100.1.v4.1 annot-version=v4.1 ATGAAGGTTCCTGAGTGGGCTTATGGGGTTCCTCCTATTAGTGTTATTGGGGAAAGCTATTGTACTCCTTACCCCCTTGAGTTGATTGTCAAGAAGAAGA TTAATAAACTATCCAGTTCGCAATTTCAAGTGTTTGATCTCAGTGGAAACTTTCTCCTAAAGGTAGATGGTGGTGTCTGGAACTTCAAGCTGAAAAGAGT TTTGCTTGATCCTGCTGGTTTTCCAATCCTCACATTGCGGGGAAAGGCACTTGCATTTCGGCATAAATGGAAGGCTCACGCAGGTGAAAGCACACACGAC ACCAGCAATATCCTCTTCTCTGTGAAGCAATCTCATCCTCTCCAGATTAAAAAACAGATCAATATCTTCTTGGCAAACAACTTCAAGAAAAAGGAACCTG ACTTCCATATAACTGGAGCTTACACATCCTTGTCATTCAAAGTTTATGAAGGCCGTAGACTCATTGCAGAGGTCAAACATAACTTCACTCTTGAAAGTTT CTGCAAGGGAAAGGAGAAATACAAGGTTAAAGTTTATCCAGAGGTTGATTATGCATTCATCGTGGCATTGCTGGTGATTCTTGATGAGAATGACACCCCT TGA
AA sequence Show only first row Show all	>Potri.008G075100.1 pacid=42805935 polypeptide=Potri.008G075100.1.p locus=Potri.008G075100 ID=Potri.008G075100.1.v4.1 annot-version=v4.1 MKVPEWAYGVPPISVIGESYCTPYPLELIVKKKINKLSSSQFQVFDLSGNFLLKVDGGVWNFKLKRVLLDPAGFPILTLRGKALAFRHKWKAHAGESTHD TSNILFSVKQSHPLQIKKQINIFLANNFKKKEPDFHITGAYTSLSFKVYEGRRLIAEVKHNFTLESFCKGKEKYKVKVYPEVDYAFIVALLVILDENDTP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G56180			Protein of unknown function (D...		Potri.008G075100 [exp]	0	1
AT1G24400		ATLHT2, AATL2, ...	ARABIDOPSIS LYSINE HISTIDINE T...		Potri.008G179000 [exp]	1.73	0.9881
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Potri.001G256600 [exp]	2.44	0.9870
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Potri.013G012666 [exp]	3.16	0.9743
AT5G53540			P-loop containing nucleoside t...		Potri.012G022985 [exp]	4.89	0.9706
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Potri.006G001600 [exp]	6.32	0.9082
AT4G02550			unknown protein		Potri.011G088750 [exp]	8.42	0.7346
AT1G29740			Leucine-rich repeat transmembr...		Potri.011G073541 [exp]	16.12	0.7905
AT3G21690			MATE efflux family protein (.1...		Potri.014G153100 [exp]	18.33	0.8689
					Potri.006G228650 [exp]	21.16	0.8630
AT4G13090		XTH2	xyloglucan endotransglucosylas...		Potri.002G244200 [exp]	22.27	0.8526	Pt-XTH2.1

Compare expression of checked genes

Potri.008G075100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.