Potri.008G075200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G10985 132 / 4e-41 WI12, ATWI-12, SAG20 ARABIDOPSIS THALIANA WOUND-INDUCED PROTEIN 12, senescence associated gene 20 (.1)
AT5G01740 64 / 1e-13 Nuclear transport factor 2 (NTF2) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G182200 192 / 6e-65 AT3G10985 123 / 8e-38 ARABIDOPSIS THALIANA WOUND-INDUCED PROTEIN 12, senescence associated gene 20 (.1)
Potri.019G125900 95 / 9e-26 AT3G10985 93 / 9e-25 ARABIDOPSIS THALIANA WOUND-INDUCED PROTEIN 12, senescence associated gene 20 (.1)
Potri.013G153801 94 / 9e-25 AT3G10985 88 / 3e-22 ARABIDOPSIS THALIANA WOUND-INDUCED PROTEIN 12, senescence associated gene 20 (.1)
Potri.016G129500 79 / 2e-19 AT5G01740 179 / 2e-58 Nuclear transport factor 2 (NTF2) family protein (.1)
Potri.016G129600 75 / 4e-18 AT5G01740 179 / 2e-58 Nuclear transport factor 2 (NTF2) family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017421 133 / 3e-40 AT5G01740 115 / 2e-32 Nuclear transport factor 2 (NTF2) family protein (.1)
Lus10010223 129 / 6e-36 AT5G17680 218 / 6e-58 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10001261 72 / 3e-16 AT5G01740 139 / 1e-41 Nuclear transport factor 2 (NTF2) family protein (.1)
Lus10022755 62 / 1e-12 AT5G01740 135 / 5e-40 Nuclear transport factor 2 (NTF2) family protein (.1)
Lus10029439 57 / 8e-11 AT5G01740 128 / 3e-37 Nuclear transport factor 2 (NTF2) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0051 NTF2 PF07107 WI12 Wound-induced protein WI12
Representative CDS sequence
>Potri.008G075200.1 pacid=42806286 polypeptide=Potri.008G075200.1.p locus=Potri.008G075200 ID=Potri.008G075200.1.v4.1 annot-version=v4.1
ATGCGCCTTCTCACTGGTGAACAAAAAGACAACGACGTGCCGTTCGAGTTCTCGCCTCTTTCCATCACCTCTTTCGGAAACATTGTGGTTGTTGAAGGGT
GTGATACCAGTCGTTCCATTTCTTGGGTGCACGCTTGGACTGTTACGGATGGGGTAATTACCCAGGTTAGAGAGTACTTCAATACCTCTCTTACTGTTAC
TCGTCTTGGAAACCAATCACAGTCGTCTGATTTTAAGTCCAAGTCAAAGTCATCATCAACGACTGAGATTTCTCCTGTGCATTGCCCATCCGTCTGGGAG
AGTAGTCTCTCCGACCGGATCGGTAAGTCCGTTCCGGGTTTGGTTCTGGCTATTTGA
AA sequence
>Potri.008G075200.1 pacid=42806286 polypeptide=Potri.008G075200.1.p locus=Potri.008G075200 ID=Potri.008G075200.1.v4.1 annot-version=v4.1
MRLLTGEQKDNDVPFEFSPLSITSFGNIVVVEGCDTSRSISWVHAWTVTDGVITQVREYFNTSLTVTRLGNQSQSSDFKSKSKSSSTTEISPVHCPSVWE
SSLSDRIGKSVPGLVLAI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G10985 WI12, ATWI-12, ... ARABIDOPSIS THALIANA WOUND-IND... Potri.008G075200 0 1
AT2G35795 Chaperone DnaJ-domain superfam... Potri.012G038800 5.65 0.9337
AT1G16810 unknown protein Potri.005G174400 5.83 0.9376
AT2G45380 unknown protein Potri.014G069100 7.28 0.9376
AT3G24500 MBF1C, ATMBF1C multiprotein bridging factor 1... Potri.018G075200 10.53 0.9347
AT5G49220 Protein of unknown function (D... Potri.010G000700 15.32 0.9287
AT4G21320 HSA32 HEAT-STRESS-ASSOCIATED 32, Ald... Potri.011G031600 18.30 0.8653
AT5G63830 HIT-type Zinc finger family pr... Potri.003G145100 20.14 0.9066
Potri.014G081150 20.44 0.8153
AT4G22740 glycine-rich protein (.1.2) Potri.003G115400 21.49 0.9194
AT1G09140 ATSRP30.1, ATSR... Serine/Arginine-Rich Protein S... Potri.005G024600 24.16 0.9165

Potri.008G075200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.