Plant FIBer expression Database

Potri.008G075600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G56210 198 / 6e-65 ARM repeat superfamily protein (.1.2.4.5)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G181700
[exp]
52 / 3e-09 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017416
[exp]
222 / 1e-73 AT3G56210 223 / 6e-74 ARM repeat superfamily protein (.1.2.4.5)
Lus10010218
[exp]
166 / 2e-52 AT3G56210 162 / 5e-51 ARM repeat superfamily protein (.1.2.4.5)
PFAM info
Representative CDS sequence
>Potri.008G075600.1 pacid=42808778 polypeptide=Potri.008G075600.1.p locus=Potri.008G075600 ID=Potri.008G075600.1.v4.1 annot-version=v4.1
ATGCGCGCGCTTAAGAACTATTTGTGTCGTTTTAATCCTCGAAATGTTCCATCTCGCCACTTCTCATCATCCCCATCACCATTCAGTAAAATAGATGAGC
TATCCATTGAAGAAGATGCTGAGAGGAAAATTGGATGGTTGCTGAAATCAATCTTTGTCGGGACCGCAGTCTTTGTTGGTTATCAGTTCTTTCCTTACAT
GGGAGATAATATGTTGCGACAGTCGGTTTCGCTTTTGCACGTTAAAGATCCCTTCTTTAAAAGAAGTGGAGCTTCTAGACTAGCCCGTTTCGCCATTGAT
GATGAAAGAAGGATGAAAATAGTGGAGATAGGTGGGGCTCAAGAGTTGTTGATCATGCTGGAAGCTGCAAAAGAAGACCGCACCAGGAAAGCAGCTTTGA
AAGCTCTTGCTGCCCTCTCACAGTCAGATGAAGCTCTAGGAGCTTTACACCTTGCTGGGGCAATATCGGTGATTAAGTCTATCCCAGATTCCTCTGAGGA
AGCAGAAATTGAGAAATTCAAGGCTAGCTTACTGAAGAGGTTCCAGGATCTGAAATATGAGAACTCATCTTAA
AA sequence
>Potri.008G075600.1 pacid=42808778 polypeptide=Potri.008G075600.1.p locus=Potri.008G075600 ID=Potri.008G075600.1.v4.1 annot-version=v4.1
MRALKNYLCRFNPRNVPSRHFSSSPSPFSKIDELSIEEDAERKIGWLLKSIFVGTAVFVGYQFFPYMGDNMLRQSVSLLHVKDPFFKRSGASRLARFAID
DERRMKIVEIGGAQELLIMLEAAKEDRTRKAALKALAALSQSDEALGALHLAGAISVIKSIPDSSEEAEIEKFKASLLKRFQDLKYENSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G56210 ARM repeat superfamily protein... Potri.008G075600
[exp]
0 1
AT1G56070 LOS1, AT1G56075... LOW EXPRESSION OF OSMOTICALLY ... Potri.005G098100
[exp]
6.00 0.8666 LOS1.3
AT1G80670 RAE1 RNA export factor 1, Transduci... Potri.003G180000
[exp]
8.83 0.8191
AT4G16720 Ribosomal protein L23/L15e fam... Potri.013G106800
[exp]
9.84 0.8902 Pt-RPL15.2
AT5G35530 Ribosomal protein S3 family pr... Potri.015G071700
[exp]
14.07 0.8704
AT5G27430 Signal peptidase subunit (.1) Potri.006G234600
[exp]
14.66 0.8180 SPP.3
AT3G09890 Ankyrin repeat family protein ... Potri.006G121500
[exp]
14.69 0.8215
AT3G03100 NADH:ubiquinone oxidoreductase... Potri.019G051400
[exp]
14.86 0.8440
AT4G03150 unknown protein Potri.014G135400
[exp]
22.40 0.7476
AT4G16720 Ribosomal protein L23/L15e fam... Potri.003G078700
[exp]
22.44 0.8377 Pt-RPL15.4
AT2G37190 Ribosomal protein L11 family p... Potri.018G146600
[exp]
22.91 0.8621 RPL12.2

Potri.008G075600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.