Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-PNFT3.4
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65480 269 / 2e-93 FT FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT4G20370 256 / 2e-88 TSF TWIN SISTER OF FT, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT5G62040 192 / 2e-63 BFT brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT5G03840 186 / 2e-60 TFL-1, TFL1 TERMINAL FLOWER 1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT2G27550 179 / 7e-58 ATC centroradialis (.1) AT1G18100 155 / 1e-48 MFT, E12A11 MOTHER OF FT AND TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G179700 [exp] 308 / 3e-109 AT1G65480 286 / 2e-100 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.004G203900 [exp] 194 / 4e-64 AT2G27550 286 / 4e-100 centroradialis (.1) Potri.009G165100 [exp] 192 / 4e-63 AT2G27550 293 / 7e-103 centroradialis (.1) Potri.015G041000 [exp] 149 / 3e-46 AT1G18100 291 / 2e-102 MOTHER OF FT AND TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.010G179900 [exp] 144 / 4e-45 AT1G65480 132 / 6e-41 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.010G179801 [exp] 142 / 1e-44 AT1G65480 133 / 3e-41 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.015G141300 [exp] 143 / 3e-44 AT5G62040 217 / 1e-73 brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013532 [exp] 298 / 7e-105 AT1G65480 278 / 6e-97 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10004452 [exp] 288 / 5e-98 AT1G65480 270 / 1e-90 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10027442 [exp] 186 / 2e-60 AT5G62040 248 / 4e-85 brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10021372 [exp] 178 / 1e-57 AT5G03840 267 / 1e-92 TERMINAL FLOWER 1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10005753 [exp] 177 / 4e-57 AT5G62040 241 / 5e-82 brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10020600 [exp] 174 / 7e-56 AT2G27550 263 / 3e-91 centroradialis (.1) Lus10004886 [exp] 171 / 1e-54 AT2G27550 267 / 2e-92 centroradialis (.1) Lus10043385 [exp] 157 / 5e-49 AT2G27550 259 / 2e-89 centroradialis (.1) Lus10002592 [exp] 151 / 1e-46 AT1G18100 207 / 6e-69 MOTHER OF FT AND TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10018417 [exp] 145 / 2e-44 AT1G18100 205 / 4e-68 MOTHER OF FT AND TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01161 [poplar] [flax] PBP Phosphatidylethanolamine-binding protein
Representative CDS sequence Show only first row Show all	>Potri.008G077700.1 pacid=42808686 polypeptide=Potri.008G077700.1.p locus=Potri.008G077700 ID=Potri.008G077700.1.v4.1 annot-version=v4.1 ATGTCAAGGGACAGAGATCCTCTGAGCGTTGGCCGTGTTATAGGGGACGTGCTGGACCCCTTCACAAAGTCTATCTCCCTCAGGGTCACTTACAGCTCCA GAGAGGTCAACAATGGTTGCGAGCTCAAGCCCTCTCAGGTTGCCAACCAGCCTAGGGTTGATATTGGCGGGGAAGATCTAAGGACCTTCTACACTCTGGT TATGGTGGACCCTGATGCACCCAGCCCAAGTGACCCCAGCCTAAGAGAATATTTGCATTGGTTGGTGACTGATATTCCAGCAACAACTGGGGCAAGCTTT GGCCATGAAACTGTGTGCTATGAGAGCCCGAGGCCGACAATGGGAATTCATCGGTTTGTTTTCGTCTTGTTTCGGCAACTGGGCAGGCAAACTGTGTATG CCCCTGGGTGGCGCCAGAACTTCAACACCAGAGACTTTGCTGAGGTCTACAATCTTGGATCGCCAGTGGCTGCTGTTTATTTCAACTGCCAGAGGGAGAG TGGCTCTGGTGGTAGGAGGCGATAA
AA sequence Show only first row Show all	>Potri.008G077700.1 pacid=42808686 polypeptide=Potri.008G077700.1.p locus=Potri.008G077700 ID=Potri.008G077700.1.v4.1 annot-version=v4.1 MSRDRDPLSVGRVIGDVLDPFTKSISLRVTYSSREVNNGCELKPSQVANQPRVDIGGEDLRTFYTLVMVDPDAPSPSDPSLREYLHWLVTDIPATTGASF GHETVCYESPRPTMGIHRFVFVLFRQLGRQTVYAPGWRQNFNTRDFAEVYNLGSPVAAVYFNCQRESGSGGRRR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G65480		FT	FLOWERING LOCUS T, PEBP (phosp...		Potri.008G077700 [exp]	0	1	Pt-PNFT3.4
AT2G32460	MYB	ATMYB101, AtM1	ARABIDOPSIS THALIANA MYB 1, my...		Potri.002G228700 [exp]	4.89	0.6849
AT2G26450			Plant invertase/pectin methyle...		Potri.018G051200 [exp]	6.92	0.8504
AT5G44265			Bifunctional inhibitor/lipid-t...		Potri.007G138400 [exp]	7.74	0.8248
AT1G40390			DNAse I-like superfamily prote...		Potri.003G066101 [exp]	7.93	0.7057
AT5G10820			Major facilitator superfamily ...		Potri.018G017400 [exp]	8.06	0.7826
AT5G27470			seryl-tRNA synthetase / serine...		Potri.007G070501 [exp]	8.36	0.7784
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Potri.009G083500 [exp]	10.48	0.6913
AT2G31335			unknown protein		Potri.005G221200 [exp]	13.07	0.5524
AT3G05610			Plant invertase/pectin methyle...		Potri.005G022900 [exp]	14.00	0.6701	PEF1.2
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Potri.006G012900 [exp]	14.07	0.6326

Compare expression of checked genes

Potri.008G077700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.