Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43290 48 / 7e-08 MSS3 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) AT1G05990 45 / 3e-07 RHS1 ,RHS2 ROOT HAIR SPECIFIC 1, EF hand calcium-binding protein family (.1) AT4G04695 44 / 3e-06 CPK31 calcium-dependent protein kinase 31 (.1) AT3G59440 44 / 3e-06 Calcium-binding EF-hand family protein (.1) AT1G76650 43 / 6e-06 CML38 calmodulin-like 38 (.1.2.3) AT4G04700 41 / 3e-05 CPK27 calcium-dependent protein kinase 27 (.1) AT1G76640 40 / 3e-05 Calcium-binding EF-hand family protein (.1) AT2G34020 39 / 0.0002 Calcium-binding EF-hand family protein (.1) AT1G29025 38 / 0.0003 Calcium-binding EF-hand family protein (.1) AT4G04720 37 / 0.0006 CPK21 calcium-dependent protein kinase 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G079132 [exp] 157 / 2e-51 AT1G05990 45 / 5e-07 ROOT HAIR SPECIFIC 1, EF hand calcium-binding protein family (.1) Potri.002G126900 [exp] 98 / 3e-28 AT4G26470 40 / 4e-05 Calcium-binding EF-hand family protein (.1.2) Potri.014G030100 [exp] 60 / 4e-13 AT1G18210 54 / 2e-10 Calcium-binding EF-hand family protein (.1.2) Potri.014G030500 [exp] 55 / 2e-11 ND / Potri.002G127000 [exp] 52 / 3e-10 AT4G25970 44 / 2e-06 phosphatidylserine decarboxylase 3 (.1) Potri.014G030700 [exp] 51 / 7e-10 ND / Potri.007G042700 [exp] 49 / 5e-09 AT3G20410 42 / 2e-05 calmodulin-domain protein kinase 9 (.1) Potri.014G030900 [exp] 49 / 6e-09 AT1G66400 41 / 2e-05 calmodulin like 23 (.1) Potri.017G029700 [exp] 50 / 9e-09 AT3G07490 192 / 1e-62 calmodulin-like 3, ARF-GAP domain 11 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009564 [exp] 48 / 7e-08 AT3G07490 233 / 7e-80 calmodulin-like 3, ARF-GAP domain 11 (.1) Lus10006777 [exp] 41 / 3e-05 AT4G04720 764 / 0.0 calcium-dependent protein kinase 21 (.1) Lus10018012 [exp] 40 / 4e-05 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2) Lus10028657 [exp] 40 / 9e-05 AT1G21550 122 / 9e-36 Calcium-binding EF-hand family protein (.1) Lus10020046 [exp] 40 / 0.0001 AT4G04720 764 / 0.0 calcium-dependent protein kinase 21 (.1) Lus10002075 [exp] 39 / 0.0002 AT4G04720 536 / 0.0 calcium-dependent protein kinase 21 (.1) Lus10038088 [exp] 39 / 0.0002 AT3G07490 150 / 7e-46 calmodulin-like 3, ARF-GAP domain 11 (.1) Lus10006644 [exp] 38 / 0.0003 AT3G07490 148 / 3e-45 calmodulin-like 3, ARF-GAP domain 11 (.1) Lus10027701 [exp] 38 / 0.0004 AT2G43290 153 / 2e-46 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13202 [poplar] [flax] EF-hand_5 EF hand CL0220 [poplar] [flax] EF_hand PF13833 [poplar] [flax] EF-hand_8 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.008G079066.1 pacid=42806993 polypeptide=Potri.008G079066.1.p locus=Potri.008G079066 ID=Potri.008G079066.1.v4.1 annot-version=v4.1 ATGGGGTTTGAAGTCAGGAAATATAAACCACGCGAGCCTAAACTACCTGTTTCTCAGCTAACTAAAGAGCAGTTGAGGGCAATTTTCATGGAGTCCGATA TCAACAAGGACGGTGTTCTCAGCAAGAAAGAGCTAAAGCAAGCCTTCGGTCGTCTGGGTGCATTTATCCCCGCCTTTAGAGCCGCCCGTGGGCTCCACCA TGCCGATGCCAACCACGATGGGGTTGTAGACAAGGATGAGTTGGATGATCTCATCAAATATGCTTATCGTCTCGGGTACAAGGTTGCTTAG
AA sequence Show only first row Show all	>Potri.008G079066.1 pacid=42806993 polypeptide=Potri.008G079066.1.p locus=Potri.008G079066 ID=Potri.008G079066.1.v4.1 annot-version=v4.1 MGFEVRKYKPREPKLPVSQLTKEQLRAIFMESDINKDGVLSKKELKQAFGRLGAFIPAFRAARGLHHADANHDGVVDKDELDDLIKYAYRLGYKVA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G43290		MSS3	multicopy suppressors of snf4 ...		Potri.008G079066 [exp]	0	1
AT1G32250			Calcium-binding EF-hand family...		Potri.014G030200 [exp]	1.00	0.9906
AT4G08300			nodulin MtN21 /EamA-like trans...		Potri.005G176200 [exp]	5.29	0.9844
AT3G20395			RING/U-box superfamily protein...		Potri.001G435800 [exp]	6.32	0.9462
					Potri.005G168401 [exp]	6.48	0.9834
AT3G25400			unknown protein		Potri.010G069700 [exp]	6.92	0.9395
AT4G35770		ATSEN1, DIN1, S...	SENESCENCE ASSOCIATED GENE 1, ...		Potri.002G014900 [exp]	8.66	0.9689
AT3G16360		AHP4	HPT phosphotransmitter 4 (.1.2...		Potri.001G189900 [exp]	9.89	0.9829
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Potri.002G035000 [exp]	10.19	0.9819
					Potri.007G034101 [exp]	10.81	0.9818
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Potri.014G190300 [exp]	12.16	0.8547

Compare expression of checked genes

Potri.008G079066 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.