Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76640 45 / 7e-07 Calcium-binding EF-hand family protein (.1) AT4G03290 45 / 7e-07 EF hand calcium-binding protein family (.1) AT4G04695 45 / 1e-06 CPK31 calcium-dependent protein kinase 31 (.1) AT1G76650 44 / 2e-06 CML38 calmodulin-like 38 (.1.2.3) AT4G04700 44 / 2e-06 CPK27 calcium-dependent protein kinase 27 (.1) AT4G04720 39 / 0.0001 CPK21 calcium-dependent protein kinase 21 (.1) AT1G73630 38 / 0.0002 EF hand calcium-binding protein family (.1) AT1G24620 37 / 0.0005 EF hand calcium-binding protein family (.1) AT1G29025 37 / 0.0006 Calcium-binding EF-hand family protein (.1) AT1G21550 37 / 0.0006 Calcium-binding EF-hand family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G079066 [exp] 157 / 1e-51 AT2G43290 48 / 8e-08 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) Potri.002G126900 [exp] 93 / 4e-26 AT4G26470 40 / 4e-05 Calcium-binding EF-hand family protein (.1.2) Potri.014G030100 [exp] 66 / 2e-15 AT1G18210 54 / 2e-10 Calcium-binding EF-hand family protein (.1.2) Potri.014G030500 [exp] 57 / 4e-12 ND / Potri.002G127000 [exp] 52 / 4e-10 AT4G25970 44 / 2e-06 phosphatidylserine decarboxylase 3 (.1) Potri.014G030700 [exp] 51 / 1e-09 ND / Potri.014G030900 [exp] 50 / 2e-09 AT1G66400 41 / 2e-05 calmodulin like 23 (.1) Potri.014G030800 [exp] 49 / 6e-09 AT3G03430 40 / 9e-06 Calcium-binding EF-hand family protein (.1) Potri.007G042700 [exp] 49 / 1e-08 AT3G20410 42 / 2e-05 calmodulin-domain protein kinase 9 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006777 [exp] 43 / 8e-06 AT4G04720 764 / 0.0 calcium-dependent protein kinase 21 (.1) Lus10038088 [exp] 43 / 9e-06 AT3G07490 150 / 7e-46 calmodulin-like 3, ARF-GAP domain 11 (.1) Lus10006644 [exp] 42 / 1e-05 AT3G07490 148 / 3e-45 calmodulin-like 3, ARF-GAP domain 11 (.1) Lus10018012 [exp] 42 / 2e-05 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2) Lus10039986 [exp] 42 / 2e-05 AT3G07490 132 / 3e-39 calmodulin-like 3, ARF-GAP domain 11 (.1) Lus10020046 [exp] 41 / 3e-05 AT4G04720 764 / 0.0 calcium-dependent protein kinase 21 (.1) Lus10002075 [exp] 41 / 4e-05 AT4G04720 536 / 0.0 calcium-dependent protein kinase 21 (.1) Lus10004610 [exp] 40 / 4e-05 AT3G03000 243 / 3e-83 EF hand calcium-binding protein family (.1) Lus10027081 [exp] 40 / 5e-05 AT1G18210 131 / 2e-39 Calcium-binding EF-hand family protein (.1.2) Lus10027701 [exp] 40 / 7e-05 AT2G43290 153 / 2e-46 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13202 [poplar] [flax] EF-hand_5 EF hand CL0220 [poplar] [flax] EF_hand PF13833 [poplar] [flax] EF-hand_8 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.008G079132.1 pacid=42808623 polypeptide=Potri.008G079132.1.p locus=Potri.008G079132 ID=Potri.008G079132.1.v4.1 annot-version=v4.1 ATGGAGTTTGATGCCAAGGAACCTAAACGACGCCTGCCCAAACCACTTGTTTCTCAGCTAACTGAAGAGCAGTTGAGGGCAATTTTCATGCAGTCCGATA TCAATAAGGACGGTCTTCTCAGCAAGAAAGAGCTAAAGCATGCCTTCAGTCGTCTTGGTGCGCTTATCCCTGCCTTTAGAGCCGCCCGTGGGCTCCACCA TGCCGATGCCAACCACGATGGGCTTGTAGACAAGGATGAGTTGGATGATCTCATCAAATATGCTTATCGTCTTGGGTACAAGGTTACTTAA
AA sequence Show only first row Show all	>Potri.008G079132.1 pacid=42808623 polypeptide=Potri.008G079132.1.p locus=Potri.008G079132 ID=Potri.008G079132.1.v4.1 annot-version=v4.1 MEFDAKEPKRRLPKPLVSQLTEEQLRAIFMQSDINKDGLLSKKELKHAFSRLGALIPAFRAARGLHHADANHDGLVDKDELDDLIKYAYRLGYKVT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G05990		RHS1 ,RHS2	ROOT HAIR SPECIFIC 1, EF hand ...		Potri.008G079132 [exp]	0	1
AT1G70840		MLP31	MLP-like protein 31 (.1)		Potri.017G051100 [exp]	1.00	0.9644	Pt-MSG.2
AT2G30540			Thioredoxin superfamily protei...		Potri.002G208400 [exp]	2.44	0.9595	PtrGrx9
AT5G07050			nodulin MtN21 /EamA-like trans...		Potri.005G222601 [exp]	2.82	0.9444
					Potri.008G114000 [exp]	3.16	0.9625
AT1G70840		MLP31	MLP-like protein 31 (.1)		Potri.017G051200 [exp]	3.60	0.9344	Pt-MSG.1
AT1G22030			unknown protein		Potri.001G211900 [exp]	5.91	0.9449
					Potri.012G086200 [exp]	6.00	0.9488
AT5G16740			Transmembrane amino acid trans...		Potri.014G146700 [exp]	6.48	0.9166
AT3G07510			unknown protein		Potri.014G176300 [exp]	8.94	0.9390
AT2G16050			Cysteine/Histidine-rich C1 dom...		Potri.009G170201 [exp]	10.19	0.9510

Compare expression of checked genes

Potri.008G079132 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.