Potri.008G079750 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.008G079750.1 pacid=42807311 polypeptide=Potri.008G079750.1.p locus=Potri.008G079750 ID=Potri.008G079750.1.v4.1 annot-version=v4.1
ATGGAGGGAAGCCTCATGCTCCATCTGATTCTGCTTTATTTAACAATTTTATTGATGAAGAGGCCAGTATGCCCAGAGAAACATAATCAGCATGAAGCCC
TCATAAAATTAAGCAATGGAGGGTCATATAATGAAGCCTTCACAAGATTAAGCCATGGAGGAGCATACAGTAATATAGAAAGGTCCAGGTATAGTCCTGA
ACTATCCAATGTCCGATGGCTAAAAAGAAAAAAAGAACTCGTAAAAAGAAACATACAGCAGGGCCGGCAAACTACGGCCACCGTCATGCAAGAAAGCGGT
TCCACTTCAAAATCCGCCGCATACCGCAATTTTAGTACCATGTATGGTGCAACCATCTCGGCCTAA
AA sequence
>Potri.008G079750.1 pacid=42807311 polypeptide=Potri.008G079750.1.p locus=Potri.008G079750 ID=Potri.008G079750.1.v4.1 annot-version=v4.1
MEGSLMLHLILLYLTILLMKRPVCPEKHNQHEALIKLSNGGSYNEAFTRLSHGGAYSNIERSRYSPELSNVRWLKRKKELVKRNIQQGRQTTATVMQESG
STSKSAAYRNFSTMYGATISA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.008G079750 0 1
AT5G40140 RING/U-box superfamily protein... Potri.017G073400 20.68 0.9505
AT1G30690 Sec14p-like phosphatidylinosit... Potri.005G224800 21.40 0.7945
Potri.012G082350 32.55 0.9504
Potri.001G021801 36.60 0.8785
Potri.016G138166 37.12 0.9504
AT5G09380 RNA polymerase III RPC4 (.1) Potri.005G126802 38.41 0.7799
Potri.006G062050 38.52 0.9504
AT5G05800 unknown protein Potri.008G217500 41.18 0.9504
Potri.012G045401 46.04 0.9504
AT1G06280 AS2 LBD2 LOB domain-containing protein ... Potri.013G123900 47.18 0.9504

Potri.008G079750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.