Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G54330 316 / 2e-107 NAC ANAC020 NAC domain containing protein 20 (.1) AT3G17730 266 / 8e-89 NAC ANAC057 NAC domain containing protein 57 (.1) AT1G65910 276 / 1e-87 NAC ANAC028 NAC domain containing protein 28 (.1) AT5G17260 271 / 1e-87 NAC ANAC086 NAC domain containing protein 86 (.1) AT3G03200 268 / 3e-86 NAC ANAC045 NAC domain containing protein 45 (.1) AT5G46590 222 / 1e-70 NAC ANAC096 NAC domain containing protein 96 (.1) AT4G17980 218 / 2e-69 NAC ANAC071 NAC domain containing protein 71 (.1) AT1G32510 208 / 2e-65 NAC ANAC011 NAC domain containing protein 11 (.1) AT3G10500 213 / 2e-64 NAC ANAC053 NAC domain containing protein 53 (.1) AT3G10490 201 / 2e-63 NAC ANAC051, ANAC052 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G174600 [exp] 589 / 0 AT1G54330 290 / 2e-97 NAC domain containing protein 20 (.1) Potri.017G139500 [exp] 291 / 4e-93 AT1G65910 461 / 1e-154 NAC domain containing protein 28 (.1) Potri.004G081000 [exp] 288 / 9e-92 AT1G65910 465 / 4e-156 NAC domain containing protein 28 (.1) Potri.015G030200 [exp] 264 / 8e-88 AT3G17730 374 / 6e-133 NAC domain containing protein 57 (.1) Potri.012G038100 [exp] 254 / 2e-83 AT3G17730 339 / 4e-118 NAC domain containing protein 57 (.1) Potri.003G089800 [exp] 233 / 5e-74 AT4G17980 319 / 6e-109 NAC domain containing protein 71 (.1) Potri.001G144400 [exp] 229 / 2e-72 AT4G17980 318 / 2e-108 NAC domain containing protein 71 (.1) Potri.008G031800 [exp] 216 / 1e-65 AT5G04410 511 / 6e-177 Arabidopsis NAC domain containing protein 78, NAC domain containing protein 2 (.1) Potri.010G229700 [exp] 209 / 7e-64 AT3G10480 418 / 8e-144 NAC domain containing protein 50 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007377 [exp] 283 / 5e-90 AT1G65910 431 / 7e-143 NAC domain containing protein 28 (.1) Lus10020794 [exp] 282 / 9e-88 AT5G10360 449 / 8e-153 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2) Lus10042284 [exp] 265 / 3e-87 AT3G17730 348 / 1e-121 NAC domain containing protein 57 (.1) Lus10026373 [exp] 265 / 4e-87 AT3G17730 348 / 2e-121 NAC domain containing protein 57 (.1) Lus10010959 [exp] 268 / 8e-85 AT1G65910 389 / 9e-128 NAC domain containing protein 28 (.1) Lus10035373 [exp] 230 / 5e-73 AT4G17980 280 / 2e-93 NAC domain containing protein 71 (.1) Lus10030978 [exp] 230 / 5e-73 AT4G17980 273 / 6e-91 NAC domain containing protein 71 (.1) Lus10037939 [exp] 205 / 1e-62 AT3G10490 415 / 2e-143 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2) Lus10023537 [exp] 199 / 1e-60 AT3G10490 331 / 2e-110 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2) Lus10028824 [exp] 200 / 2e-59 AT5G04410 378 / 5e-125 Arabidopsis NAC domain containing protein 78, NAC domain containing protein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.008G081500.1 pacid=42807017 polypeptide=Potri.008G081500.1.p locus=Potri.008G081500 ID=Potri.008G081500.1.v4.1 annot-version=v4.1 ATGGCACCCATGAGCCTCCCTCCTGGATTTAGGTTCCATCCAACCGATGAAGAGCTTGTTGCGTACTATCTTGATCGGAAAATCAACGGCCACACAATTG AGCTTGAAATTATCCCAGAGGTTGATCTCTATAAATGCGAGCCGTGGGACTTGCCAGACAAGTCATTTTTACCGAGCAAAGATATGGAGTGGTATTTTTA TAGCCCCAGGGATAAGAAGTACCCTAATGGGTCAAGAACTAACAGGGCAACAAGGGCTGGTTACTGGAAAGCCACAGGGAAAGATAGACCAGTGCAGTCT CAGAAGCGGCCAGCTGGCATGAAGAAGACATTGGTGTACTATAGAGGTAGAGCTCCTCATGGAATCAGAACCAACTGGGTAATGCATGAGTATCGCTTGA TCGACTCATTTTGTGGCAATGCATCATCAATTTTAAAGGATTCCTATGCATTATGCCGTGTTTTCAGGAAAACAGTACAAACTCCCAAAACAAAAGAAGA GAAAAATGTTGGTGATGAAGAGAGGGATATTGCAGCGTGGGTCTCAGAAGAACAATTATTGGGGGATAACAAATGCCGTATTGAAATTTCTAAAGGGAGA GAAGCTGAAGGTGAAAATTTCAACAATGACTATTGTAAATTCCCATCTGAAACATCTTCCTCAGATGTCACCCAAGGGACTCCAATTGAAACTGCAACGG CCGATGATTTGCTAGCTCCAATTGCCTCGGATGAAGCCAATAGCTCAGCTAACATTTACTCAGTGGGCGTGGATTTCTCGTCGAATCTAATTCAGGATAT GCAGATGCCAGTCTACTCAAGCTTGCTCTATCAATTCCCGTACCCTTCTTTAGAACTAGAAGACTTCCCACAGATTAACATCGCCGAGTGTGTGAAGCCA TCCAAGCCTGAAATTAGCGACGAATACATGATGTACAAGGATTGCATGGACGGAACATTAGAACAACTATGTTCCTCTCAAGACAACTCCAATACTGTAC TCCCCCATGCAAGACTAATTTAG
AA sequence Show only first row Show all	>Potri.008G081500.1 pacid=42807017 polypeptide=Potri.008G081500.1.p locus=Potri.008G081500 ID=Potri.008G081500.1.v4.1 annot-version=v4.1 MAPMSLPPGFRFHPTDEELVAYYLDRKINGHTIELEIIPEVDLYKCEPWDLPDKSFLPSKDMEWYFYSPRDKKYPNGSRTNRATRAGYWKATGKDRPVQS QKRPAGMKKTLVYYRGRAPHGIRTNWVMHEYRLIDSFCGNASSILKDSYALCRVFRKTVQTPKTKEEKNVGDEERDIAAWVSEEQLLGDNKCRIEISKGR EAEGENFNNDYCKFPSETSSSDVTQGTPIETATADDLLAPIASDEANSSANIYSVGVDFSSNLIQDMQMPVYSSLLYQFPYPSLELEDFPQINIAECVKP SKPEISDEYMMYKDCMDGTLEQLCSSQDNSNTVLPHARLI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G54330	NAC	ANAC020	NAC domain containing protein ...		Potri.008G081500 [exp]	0	1
AT2G28930		APK1B	protein kinase 1B (.1.2.3)		Potri.009G031300 [exp]	3.16	0.8514	APK1.1
AT1G31690			Copper amine oxidase family pr...		Potri.008G151900 [exp]	4.24	0.8448	DAO.3
AT3G61550			RING/U-box superfamily protein...		Potri.014G091000 [exp]	6.92	0.8261
AT2G39840		TOPP4	type one serine/threonine prot...		Potri.010G071850 [exp]	7.14	0.8355
AT3G22104			Phototropic-responsive NPH3 fa...		Potri.007G118800 [exp]	8.24	0.8323
AT1G55850		ATCSLE1	cellulose synthase like E1 (.1...		Potri.001G369100 [exp]	9.48	0.8293	ATCSLE1.1
AT2G01150		RHA2B	RING-H2 finger protein 2B (.1)		Potri.008G125700 [exp]	10.00	0.8163	RHA2.1
					Potri.011G046112 [exp]	11.61	0.8299
AT3G48080			alpha/beta-Hydrolases superfam...		Potri.012G074600 [exp]	12.00	0.7776	EDS1.1
AT1G66200		ATGSR2, GLN1;2	glutamine synthetase 1;2, glut...		Potri.017G127901 [exp]	13.11	0.7731

Compare expression of checked genes

Potri.008G081500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.