Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G79510 192 / 1e-62 Uncharacterized conserved protein (DUF2358) (.1), Uncharacterized conserved protein (DUF2358) (.2) AT1G16320 187 / 1e-60 Uncharacterized conserved protein (DUF2358) (.1) AT2G46220 96 / 2e-25 Uncharacterized conserved protein (DUF2358) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G173000 [exp] 214 / 2e-71 AT1G79510 357 / 4e-125 Uncharacterized conserved protein (DUF2358) (.1), Uncharacterized conserved protein (DUF2358) (.2) Potri.014G092200 [exp] 79 / 4e-19 AT2G46220 273 / 5e-93 Uncharacterized conserved protein (DUF2358) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001766 [exp] 162 / 6e-51 AT1G79510 281 / 3e-95 Uncharacterized conserved protein (DUF2358) (.1), Uncharacterized conserved protein (DUF2358) (.2) Lus10009597 [exp] 157 / 6e-49 AT1G79510 284 / 2e-96 Uncharacterized conserved protein (DUF2358) (.1), Uncharacterized conserved protein (DUF2358) (.2) Lus10010135 [exp] 94 / 2e-24 AT2G46220 254 / 2e-85 Uncharacterized conserved protein (DUF2358) (.1) Lus10012651 [exp] 94 / 3e-24 AT2G46220 256 / 4e-86 Uncharacterized conserved protein (DUF2358) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0051 [poplar] [flax] NTF2 PF10184 [poplar] [flax] DUF2358 Uncharacterized conserved protein (DUF2358)
Representative CDS sequence Show only first row Show all	>Potri.008G083400.2 pacid=42807183 polypeptide=Potri.008G083400.2.p locus=Potri.008G083400 ID=Potri.008G083400.2.v4.1 annot-version=v4.1 ATGTTGTATAGGGAGATTTCACTTGAGGTTTATAGGATTTGGCAACCCTCGGAGAATGTGATATTGATTAGATGGAACTCAAAGGGTGTTCCCAGGATCC CATGGGAGGTTATGGGAGAGTTTCAGCGTACTTTAAGGTATAAATTGGATAGAAATGGGAAAAATTATGAGCATAAAGTGGATAATTTGGCCTTCAGTTT CCCACAACCTCTCAAACCTGCTGCTTCTGTGTTGGATTTGGTGGCTGCTTGCCCTGCTAGTCCTAATCCAACGTTTTTGTGGGGACCCGTCGACATCTGC TCGTCTTCATGGGTGGAATTTTATCGTGCTGTTAGAGAGACATGGGGCCAAGAACAGTGCCATTCACTTGTGTAA
AA sequence Show only first row Show all	>Potri.008G083400.2 pacid=42807183 polypeptide=Potri.008G083400.2.p locus=Potri.008G083400 ID=Potri.008G083400.2.v4.1 annot-version=v4.1 MLYREISLEVYRIWQPSENVILIRWNSKGVPRIPWEVMGEFQRTLRYKLDRNGKNYEHKVDNLAFSFPQPLKPAASVLDLVAACPASPNPTFLWGPVDIC SSSWVEFYRAVRETWGQEQCHSLV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G79510			Uncharacterized conserved prot...		Potri.008G083400 [exp]	0	1
AT3G04880		DRT102	DNA-DAMAGE-REPAIR/TOLERATION 2...		Potri.005G050600 [exp]	4.69	0.8377	Pt-DRT102.2
AT4G30480		TPR1, AtTPR1	tetratricopeptide repeat 1, Te...		Potri.018G100700 [exp]	5.47	0.8237
					Potri.016G052901 [exp]	6.48	0.7903
AT1G78770		APC6	anaphase promoting complex 6 (...		Potri.001G389300 [exp]	11.18	0.7819
AT1G78160		APUM7	pumilio 7 (.1)		Potri.002G095400 [exp]	11.22	0.7942
AT4G30480		TPR1, AtTPR1	tetratricopeptide repeat 1, Te...		Potri.006G178900 [exp]	13.26	0.8312
AT5G04010			F-box family protein (.1)		Potri.004G076800 [exp]	13.63	0.8361
AT4G25080		CHLM	magnesium-protoporphyrin IX me...		Potri.015G105702 [exp]	13.67	0.7958
AT5G04010			F-box family protein (.1)		Potri.004G077301 [exp]	14.96	0.8232
AT3G21090		ABCG15	ATP-binding cassette G15, ABC-...		Potri.006G049000 [exp]	20.00	0.8121

Compare expression of checked genes

Potri.008G083400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.