Potri.008G084001 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.008G084001.1 pacid=42807299 polypeptide=Potri.008G084001.1.p locus=Potri.008G084001 ID=Potri.008G084001.1.v4.1 annot-version=v4.1
ATGTTGAGGCACTCAACGATATCCTGCTTCATGGGAATCCCGTTGCTTACTATGAAAGTCATGAAACTCTTAAAAACACTACAAACTTCTACTTCTATCA
CAAGCTTTGCTTCGGATTCTTCTTCTCCTGGCTCATCTTCCTCTCGAGCAGCTTTTGCCTTTGCTCGCGACCTAGGCCGATCTACCCGATCAAATTTACC
TCCAACTCGATACACTTTCGTCCCATCTTCTAATCAACCTGGACCTCCTCCTCCTAATTTCACTTCTGGCGAACTACTACCAGTCTACCAACCTTCCCTT
GTTTGGAATTCTTCCAACCCACTTTAA
AA sequence
>Potri.008G084001.1 pacid=42807299 polypeptide=Potri.008G084001.1.p locus=Potri.008G084001 ID=Potri.008G084001.1.v4.1 annot-version=v4.1
MLRHSTISCFMGIPLLTMKVMKLLKTLQTSTSITSFASDSSSPGSSSSRAAFAFARDLGRSTRSNLPPTRYTFVPSSNQPGPPPPNFTSGELLPVYQPSL
VWNSSNPL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.008G084001 0 1
AT2G20760 Clathrin light chain protein (... Potri.019G102000 3.46 0.8380
AT3G62720 ATXT1, XXT1 XYG XYLOSYLTRANSFERASE 1, xylo... Potri.010G025100 4.89 0.8120
AT1G21720 PBC1 proteasome beta subunit C1 (.1... Potri.002G080800 15.49 0.7860 Pt-PBC2.2
Potri.005G237401 20.92 0.7362
Potri.006G226200 21.21 0.7260
Potri.011G073216 22.53 0.8311
AT4G23630 RTNLB1, BTI1 Reticulan like protein B1, VIR... Potri.012G035600 28.37 0.7869
AT1G20140 ASK4 SKP1-like 4 (.1) Potri.009G135800 30.98 0.8116 SKP1.4
AT1G16260 Wall-associated kinase family ... Potri.014G148400 32.12 0.7055
AT2G16920 UBC23 ,PFU2 PHO2 FAMILY UBIQUITIN CONJUGAT... Potri.013G108500 32.61 0.7902

Potri.008G084001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.