Potri.008G087100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14205 202 / 2e-67 Ribosomal L18p/L5e family protein (.1)
AT1G48350 81 / 2e-19 EMB3105 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G005000 75 / 3e-17 AT1G48350 229 / 4e-78 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012820 186 / 1e-60 AT1G14205 182 / 2e-59 Ribosomal L18p/L5e family protein (.1)
Lus10030465 176 / 3e-57 AT1G14205 174 / 2e-56 Ribosomal L18p/L5e family protein (.1)
Lus10039092 73 / 1e-16 AT1G48350 216 / 6e-73 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
Lus10038770 73 / 2e-16 AT1G48350 216 / 6e-73 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0267 S11_L18p PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Representative CDS sequence
>Potri.008G087100.4 pacid=42808000 polypeptide=Potri.008G087100.4.p locus=Potri.008G087100 ID=Potri.008G087100.4.v4.1 annot-version=v4.1
ATGGCTGTTAGGAGTGTTCCTTCCGCACTCCCGTTCAAAACTTGTGATGTCTTTGGAAACCCTTTAAAACCTTTTAATTTCCTTCCCATACAAACTAGAA
ATTTTCAAACAAAGACATTGGTGGCGAAAAGAAGAGCAAATACTCGAACAGAAAGTGCGAAAATCAGAAATAGAAGAACACTAAAGAAGTTTAATGGCAC
ACGTACAAAACCAAGGCTGTCAGTTTTCTGTTCGACCAAACAGTTGTATGCCATGCTGGTAGATGACCAAAGCAAGAAGTGTTTATTTTACGGAAGCACT
TTGCAGAAACCTTTAAGCGGTGATCTCCCTCGTAGCACCATTGAAGCTGCTGAATGTCTTGGCGAAGAGCTTATTAAGGCCTGTATGGATCTTAAGATCA
ATGAAATATCATCTTATGATCGCAATGGTTTTGCCGGCGGAGAGAGAATGCAAGCTTTCGAGATTGCAATTTCTCGTCATGGATTCTTACCAAGATAG
AA sequence
>Potri.008G087100.4 pacid=42808000 polypeptide=Potri.008G087100.4.p locus=Potri.008G087100 ID=Potri.008G087100.4.v4.1 annot-version=v4.1
MAVRSVPSALPFKTCDVFGNPLKPFNFLPIQTRNFQTKTLVAKRRANTRTESAKIRNRRTLKKFNGTRTKPRLSVFCSTKQLYAMLVDDQSKKCLFYGST
LQKPLSGDLPRSTIEAAECLGEELIKACMDLKINEISSYDRNGFAGGERMQAFEIAISRHGFLPR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G14205 Ribosomal L18p/L5e family prot... Potri.008G087100 0 1
AT1G45110 Tetrapyrrole (Corrin/Porphyrin... Potri.005G232200 1.41 0.8820
AT2G47350 HIT zinc finger ;PAPA-1-like c... Potri.013G008300 6.63 0.8572
AT1G75010 ARC3 ACCUMULATION AND REPLICATION O... Potri.010G099300 6.92 0.8351
AT2G30740 Protein kinase superfamily pro... Potri.017G036501 7.07 0.8400
AT4G35270 NLP2 Plant regulator RWP-RK family ... Potri.009G166932 7.93 0.8568
AT1G12740 CYP87A2 "cytochrome P450, family 87, s... Potri.002G010532 15.23 0.8095
AT1G72050 C2H2ZnF TFIIIA transcription factor IIIA (.1.... Potri.013G108600 18.16 0.8136
AT1G28320 DEG15 protease-related (.1) Potri.011G056100 21.63 0.8515
AT5G07670 RNI-like superfamily protein (... Potri.014G059100 22.20 0.8179
AT5G26570 ATGWD3, OK1, PW... PHOSPHOGLUCAN WATER DIKINASE, ... Potri.014G147900 22.80 0.8168

Potri.008G087100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.