Potri.008G087700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G062300 39 / 3e-05 AT3G47510 53 / 1e-10 unknown protein
Potri.013G066600 38 / 0.0001 AT3G47510 40 / 2e-05 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031340 36 / 0.0003 ND 34 / 0.002
Lus10037168 36 / 0.0008 ND 33 / 0.005
PFAM info
Representative CDS sequence
>Potri.008G087700.4 pacid=42806071 polypeptide=Potri.008G087700.4.p locus=Potri.008G087700 ID=Potri.008G087700.4.v4.1 annot-version=v4.1
ATGATGCTTCAAAAGTGGCTAGAAATGGCAGGCAAATTCCTTCATTCACTAGTAATTCTACTGGTAGTTTCCCAGCTTATCTTCTTGAATGCTACCTCAA
CATCCAGGACTGGAGATGATCTATTATATAATAGTCAAGATATGCTATCTCCTGATCGGAACACCCAGCACCAGACAATCACAAAGCGAGGCGCCGGGAG
GGAGAATCTGGAGTACACTGATTATTCAGGAACAGGACCCAATAACCGCCACACTCCTGAGCCGCCTTCTGGCCAGGGGGGGAACTAA
AA sequence
>Potri.008G087700.4 pacid=42806071 polypeptide=Potri.008G087700.4.p locus=Potri.008G087700 ID=Potri.008G087700.4.v4.1 annot-version=v4.1
MMLQKWLEMAGKFLHSLVILLVVSQLIFLNATSTSRTGDDLLYNSQDMLSPDRNTQHQTITKRGAGRENLEYTDYSGTGPNNRHTPEPPSGQGGN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.008G087700 0 1
Potri.012G028801 2.23 0.8574
AT4G01250 WRKY ATWRKY22, WRKY2... WRKY family transcription fact... Potri.002G164400 2.44 0.8314
AT3G57200 unknown protein Potri.006G045500 3.74 0.8512
AT3G23640 HGL1 heteroglycan glucosidase 1 (.1... Potri.001G129600 5.91 0.8307
AT1G59740 Major facilitator superfamily ... Potri.003G000800 7.34 0.7935
AT5G26340 ATSTP13, MSS1, ... SUGAR TRANSPORT PROTEIN 13, Ma... Potri.008G151100 7.74 0.7759
Potri.012G027850 7.74 0.8165
AT4G33420 Peroxidase superfamily protein... Potri.004G134800 10.19 0.8374
AT3G21760 HYR1 HYPOSTATIN RESISTANCE 1, UDP-G... Potri.016G015700 10.95 0.8089
AT1G49780 PUB26 plant U-box 26 (.1) Potri.004G140100 11.31 0.7995

Potri.008G087700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.