Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G03050 117 / 7e-34 SOLDAT10, EMB93 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1) AT2G34620 90 / 3e-23 Mitochondrial transcription termination factor family protein (.1) AT2G36000 69 / 4e-15 EMB3114 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2) AT3G18870 67 / 7e-15 Mitochondrial transcription termination factor family protein (.1) AT1G78930 54 / 5e-10 Mitochondrial transcription termination factor family protein (.1) AT2G21710 54 / 6e-10 EMB2219 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1) AT5G55580 54 / 8e-10 Mitochondrial transcription termination factor family protein (.1) AT4G14605 52 / 5e-09 Mitochondrial transcription termination factor family protein (.1) AT4G02990 45 / 9e-07 RUG2, BSM RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1) AT2G44020 44 / 4e-06 Mitochondrial transcription termination factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G167400 [exp] 154 / 3e-48 AT2G03050 303 / 3e-103 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1) Potri.011G081400 [exp] 86 / 2e-21 AT2G34620 392 / 5e-138 Mitochondrial transcription termination factor family protein (.1) Potri.006G205000 [exp] 83 / 3e-20 AT2G36000 284 / 2e-94 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2) Potri.016G072200 [exp] 83 / 4e-20 AT2G36000 280 / 1e-92 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2) Potri.004G150600 [exp] 72 / 1e-16 AT3G18870 311 / 1e-106 Mitochondrial transcription termination factor family protein (.1) Potri.001G361800 [exp] 55 / 3e-10 AT5G55580 584 / 0.0 Mitochondrial transcription termination factor family protein (.1) Potri.014G137400 [exp] 55 / 4e-10 AT4G02990 669 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1) Potri.017G067600 [exp] 50 / 1e-08 AT4G14605 571 / 0.0 Mitochondrial transcription termination factor family protein (.1) Potri.007G001800 [exp] 50 / 1e-08 AT1G78930 633 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030451 [exp] 103 / 4e-28 AT2G03050 283 / 3e-95 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1) Lus10026612 [exp] 101 / 3e-27 AT2G03050 285 / 4e-96 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1) Lus10021297 [exp] 82 / 5e-20 AT2G36000 264 / 8e-87 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2) Lus10016971 [exp] 82 / 6e-20 AT2G36000 271 / 2e-89 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2) Lus10029422 [exp] 71 / 6e-16 AT2G36000 294 / 3e-98 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2) Lus10026325 [exp] 69 / 4e-15 AT3G18870 278 / 3e-93 Mitochondrial transcription termination factor family protein (.1) Lus10014567 [exp] 69 / 5e-15 AT2G34620 300 / 6e-101 Mitochondrial transcription termination factor family protein (.1) Lus10004219 [exp] 69 / 5e-15 AT2G36000 293 / 8e-98 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2) Lus10042342 [exp] 68 / 7e-15 AT3G18870 276 / 1e-92 Mitochondrial transcription termination factor family protein (.1) Lus10032120 [exp] 64 / 2e-13 AT2G34620 300 / 2e-101 Mitochondrial transcription termination factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02536 [poplar] [flax] mTERF mTERF
Representative CDS sequence Show only first row Show all	>Potri.008G088100.1 pacid=42805922 polypeptide=Potri.008G088100.1.p locus=Potri.008G088100 ID=Potri.008G088100.1.v4.1 annot-version=v4.1 ATGGCTGTGAGGGCACCTGGGATTTTGACTCTTAGTATGGACAGGAATTTGGGGCCTAAACTTGATTACTCTGTGAGAGAAATAAAAGGTGATTTAGAGG AATTTAAGAAGTTTCCGCAGTTCTTTTCGTTCAGTCTTGAGAGGAAGATTAAGCCTAGGCATAGAATGTTGGTGGAGTATGGACTGAAGATGCCACTGTC GAGAATGTTAAAGGTTAATGAAGGGGAATTCAACGCTAGGTTGTTTGAAATGCTGCTGAGAATGGTGGAGGGGAGGTAA
AA sequence Show only first row Show all	>Potri.008G088100.1 pacid=42805922 polypeptide=Potri.008G088100.1.p locus=Potri.008G088100 ID=Potri.008G088100.1.v4.1 annot-version=v4.1 MAVRAPGILTLSMDRNLGPKLDYSVREIKGDLEEFKKFPQFFSFSLERKIKPRHRMLVEYGLKMPLSRMLKVNEGEFNARLFEMLLRMVEGR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G03050		SOLDAT10, EMB93	SINGLET OXYGEN-LINKED DEATH AC...		Potri.008G088100 [exp]	0	1
AT5G49580			Chaperone DnaJ-domain superfam...		Potri.008G101800 [exp]	15.23	0.8159
AT2G36720			Acyl-CoA N-acyltransferase wit...		Potri.016G097300 [exp]	16.52	0.8391
AT1G33390		ATFAS4	FASCIATED STEM 4, RNA helicase...		Potri.002G201400 [exp]	21.90	0.8146
AT1G20670			DNA-binding bromodomain-contai...		Potri.009G167500 [exp]	23.32	0.8134
AT4G27190			NB-ARC domain-containing disea...		Potri.001G432366 [exp]	26.53	0.8276
AT5G43820			Pentatricopeptide repeat (PPR)...		Potri.005G247200 [exp]	32.40	0.8034
AT2G39580			unknown protein		Potri.010G208200 [exp]	33.48	0.8006
AT1G26540			Agenet domain-containing prote...		Potri.002G192300 [exp]	44.54	0.8147
AT5G21930		ATHMA8, HMA8, P...	ARABIDOPSIS HEAVY METAL ATPASE...		Potri.006G220301 [exp]	49.49	0.8360
AT4G02070		ATMSH6, MSH6-1	MUTS HOMOLOG 6-1, ARABIDOPSIS...		Potri.014G121601 [exp]	54.22	0.7840

Compare expression of checked genes

Potri.008G088100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.