Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26550 214 / 1e-72 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT2G18040 60 / 3e-12 PIN1AT "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1) AT5G19370 48 / 5e-07 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G013400 [exp] 64 / 1e-13 AT2G18040 198 / 4e-67 "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1) Potri.009G069300 [exp] 45 / 4e-06 AT5G19370 281 / 3e-94 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019084 [exp] 214 / 9e-73 AT1G26550 225 / 4e-77 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10015714 [exp] 215 / 1e-72 AT1G26550 224 / 1e-76 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10014266 [exp] 63 / 2e-13 AT2G18040 199 / 9e-68 "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1) Lus10025967 [exp] 63 / 7e-13 AT2G18040 200 / 8e-67 "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1) Lus10000413 [exp] 46 / 3e-06 AT5G19370 240 / 1e-77 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1) Lus10026105 [exp] 45 / 3e-06 AT5G19370 233 / 8e-76 rhodanese-like domain-containing protein / PPIC-type PPIASE domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [poplar] [flax] FKBP PF13616 [poplar] [flax] Rotamase_3 PPIC-type PPIASE domain
Representative CDS sequence Show only first row Show all	>Potri.008G089900.13 pacid=42806265 polypeptide=Potri.008G089900.13.p locus=Potri.008G089900 ID=Potri.008G089900.13.v4.1 annot-version=v4.1 ATGGGAAAGGACTCGAAGGCAAAAGACGCTGGAGCGAAGGGAAAGGGTAAGGGAAAGCAGGCAGGGGGTGGGAGTGATGAAAATGCTTCCAAGGGGAAAG GAAAATCTGGAAAGGCTTCAGATGGGCTCGGCACTTGCACTTATGTCAAAGCGAGGCATATATTATGTGAGAAGCAAGGCAAGATCAATGAGGCATACCA GAAGTTGCAGGATGGTTGGCTAAGCAATGGTGACAAGGTTCCTCCAGCTGAGTTTGCAAAGTTGGCTTCCGAGTACTCAGAGTGTCCATCAGGAAAGAAA GGCGGAGACCTTGGATGGTTCCCTCGAGGAAAGATGGCGGGTCCCTTTCAAGATGTGGCATTTGCCACTCAAATTGGAGCTACAAGTGCACCATTCAAGT CAACACATGGGTATCACGTAATATTGTGTGAAGGGAGGAAGAATTAA
AA sequence Show only first row Show all	>Potri.008G089900.13 pacid=42806265 polypeptide=Potri.008G089900.13.p locus=Potri.008G089900 ID=Potri.008G089900.13.v4.1 annot-version=v4.1 MGKDSKAKDAGAKGKGKGKQAGGGSDENASKGKGKSGKASDGLGTCTYVKARHILCEKQGKINEAYQKLQDGWLSNGDKVPPAEFAKLASEYSECPSGKK GGDLGWFPRGKMAGPFQDVAFATQIGATSAPFKSTHGYHVILCEGRKN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G26550			FKBP-like peptidyl-prolyl cis-...		Potri.008G089900 [exp]	0	1
AT3G48030			hypoxia-responsive family prot...		Potri.015G073300 [exp]	1.73	0.8611
AT2G04520			Nucleic acid-binding, OB-fold-...		Potri.014G160900 [exp]	2.82	0.8460
AT1G77370			Glutaredoxin family protein (....		Potri.007G017300 [exp]	4.69	0.8108	PtrcGrx_C3
AT3G08990			Yippee family putative zinc-bi...		Potri.006G015500 [exp]	5.47	0.8321
AT1G68370		ARG1	ALTERED RESPONSE TO GRAVITY 1,...		Potri.010G122300 [exp]	6.00	0.8511
AT2G21290			unknown protein		Potri.009G124700 [exp]	6.24	0.8344
AT4G08240			unknown protein		Potri.002G086200 [exp]	6.32	0.8421
AT4G14600			Target SNARE coiled-coil domai...		Potri.005G159600 [exp]	8.12	0.8409
AT3G59600		NRPE8B, NRPD8B,...	RNA polymerase Rpb8 (.1)		Potri.013G120500 [exp]	8.48	0.7828	Pt-ATRPABC16.2
AT1G76200			unknown protein		Potri.002G012700 [exp]	8.66	0.8535

Compare expression of checked genes

Potri.008G089900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.