Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	CRC.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G69180 155 / 1e-48 YABBY CRC CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1) AT2G26580 111 / 2e-31 YABBY YAB5 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) AT1G08465 104 / 2e-28 YABBY YAB2 YABBY2, Plant-specific transcription factor YABBY family protein (.1) AT2G45190 104 / 6e-28 YABBY FIL, YAB1, AFO YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) AT4G00180 103 / 1e-27 YABBY YAB3 YABBY3, Plant-specific transcription factor YABBY family protein (.1.2) AT1G23420 84 / 3e-20 YABBY INO, YAB4 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G154350 [exp] 234 / 2e-79 AT1G69180 155 / 2e-48 CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1) Potri.009G000100 [exp] 116 / 3e-33 AT1G08465 215 / 3e-72 YABBY2, Plant-specific transcription factor YABBY family protein (.1) Potri.018G129800 [exp] 116 / 7e-33 AT2G26580 250 / 5e-86 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.001G120200 [exp] 115 / 4e-32 AT2G45190 236 / 4e-79 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.002G145100 [exp] 113 / 1e-31 AT2G45190 265 / 2e-90 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.016G067300 [exp] 110 / 4e-31 AT1G08465 150 / 2e-46 YABBY2, Plant-specific transcription factor YABBY family protein (.1) Potri.003G112800 [exp] 109 / 4e-30 AT2G45190 243 / 1e-81 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.006G067800 [exp] 108 / 4e-30 AT2G26580 253 / 5e-87 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.014G066700 [exp] 108 / 7e-30 AT2G45190 277 / 3e-95 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036811 [exp] 187 / 6e-61 AT1G69180 187 / 4e-61 CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1) Lus10000644 [exp] 172 / 8e-55 AT1G69180 177 / 5e-57 CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1) Lus10024603 [exp] 103 / 2e-27 AT2G45190 190 / 2e-60 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10032240 [exp] 100 / 2e-26 AT2G45190 193 / 1e-61 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10029135 [exp] 92 / 5e-23 AT1G23420 200 / 9e-65 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1) Lus10043264 [exp] 70 / 4e-14 AT5G35410 630 / 0.0 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1) Lus10036496 [exp] 68 / 4e-14 AT2G45190 183 / 2e-58 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10019407 [exp] 68 / 5e-14 AT2G26580 228 / 8e-77 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Lus10010361 [exp] 67 / 1e-13 AT2G45190 171 / 4e-53 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10008374 [exp] 65 / 4e-13 AT1G08465 84 / 9e-21 YABBY2, Plant-specific transcription factor YABBY family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0114 [poplar] [flax] HMG-box PF04690 [poplar] [flax] YABBY YABBY protein
Representative CDS sequence Show only first row Show all	>Potri.008G097800.1 pacid=42808350 polypeptide=Potri.008G097800.1.p locus=Potri.008G097800 ID=Potri.008G097800.1.v4.1 annot-version=v4.1 ATGAACCTAGAAGAGAAAGCAAGCACAGAGGTTCCATCATCTGAGCATCTCTGCTATGTCCGTTGCAACTTCTGCAACACTGTTCTTGCGGTCGGGATTC CATGCAAGAGGCTGCTGGACACTGTGACTGTCAAATGTGGTCATTGCAATAATCTCTCCTTTCTCAGCACCAGACCTCCCAACCAAGGGCAATGTCTTGA TCAGTACCACCGACTGAGTCTACAGGGAGTTTCTAGTAATGAAAAGTTCTTATTCAATGAGAAGCAAGGGTTTTGCACTGATATCAGAAAGGGCGAATCC TCATCCTCCTCGACCTCTAGCGAACAACCGGTGCCCACAGTACCCTTCGTAGTAAAGCCGCCTGAGAAGAAACACCGACTTCCATCTGCTTACAATAGGT TTATGAAGGAGGAGATAAAGCGCATCAAAGCAGCCGATCCTGAGATACCACACAGAGAAGCTTTTAGCACAGCAGCTAAAAATTGGGCTAGGGCTAGGTA CCTTCCAAAGTCGGGTGCTGGTTCTGGGAGCCCTAATATTTAA
AA sequence Show only first row Show all	>Potri.008G097800.1 pacid=42808350 polypeptide=Potri.008G097800.1.p locus=Potri.008G097800 ID=Potri.008G097800.1.v4.1 annot-version=v4.1 MNLEEKASTEVPSSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCNNLSFLSTRPPNQGQCLDQYHRLSLQGVSSNEKFLFNEKQGFCTDIRKGES SSSSTSSEQPVPTVPFVVKPPEKKHRLPSAYNRFMKEEIKRIKAADPEIPHREAFSTAAKNWARARYLPKSGAGSGSPNI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G69180	YABBY	CRC	CRABS CLAW, Plant-specific tra...		Potri.008G097800 [exp]	0	1	CRC.1
AT5G56510		APUM12	pumilio 12 (.1)		Potri.001G298000 [exp]	15.00	1.0000
AT1G52900			Toll-Interleukin-Resistance (T...		Potri.001G403800 [exp]	18.70	1.0000
AT1G55790			Domain of unknown function (DU...		Potri.001G438200 [exp]	20.61	1.0000
					Potri.001G276804 [exp]	26.07	1.0000
					Potri.001G330250 [exp]	29.15	1.0000
AT1G21430		YUC11	Flavin-binding monooxygenase f...		Potri.005G111800 [exp]	31.62	1.0000
AT5G44840			Pectin lyase-like superfamily ...		Potri.006G252900 [exp]	35.00	1.0000
					Potri.001G466250 [exp]	40.18	1.0000
					Potri.013G052950 [exp]	43.30	1.0000
AT2G16430		ATPAP10, PAP10	purple acid phosphatase 10 (.1...		Potri.004G160200 [exp]	51.33	1.0000

Compare expression of checked genes

Potri.008G097800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.