Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66950 69 / 1e-15 ABCG39, PDR11, ATPDR11 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) AT2G36380 64 / 7e-14 ABCG34, PDR6, ATPDR6 ATP-binding cassette G34, pleiotropic drug resistance 6 (.1) AT3G53480 61 / 1e-12 PIS1, ABCG37, PDR9, ATPDR9 polar auxin transport inhibitor sensitive 1, ATP-binding cassette G37, pleiotropic drug resistance 9 (.1) AT1G15210 61 / 1e-12 ABCG35, PDR7, ATPDR7 ATP-binding cassette G35, pleiotropic drug resistance 7 (.1) AT1G15520 60 / 2e-12 ATABCG40, ABCG40, PDR12, ATPDR12 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) AT3G16340 58 / 9e-12 ABCG29, ATPDR1, PDR1, AtABCG29 ATP-binding cassette G29, pleiotropic drug resistance 1 (.1.2) AT2G37280 55 / 1e-10 ABCG33, PDR5, ATPDR5 ATP-binding cassette G33, pleiotropic drug resistance 5 (.1) AT1G59870 54 / 2e-10 ATABCG36, ABCG36, PEN3, PDR8, ATPDR8 PENETRATION 3, ARABIDOPSIS PLEIOTROPIC DRUG RESISTANCE 8, Arabidopsis thaliana ATP-binding cassette G36, ATP-binding cassette G36, ABC-2 and Plant PDR ABC-type transporter family protein (.1) AT3G30842 52 / 2e-09 ABCG38, PDR10, ATPDR10 ATP-binding cassette G38, pleiotropic drug resistance 10 (.1) AT2G29940 50 / 7e-09 ABCG31, PDR3, ATPDR3 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G153700 [exp] 89 / 1e-22 AT3G53480 1788 / 0.0 polar auxin transport inhibitor sensitive 1, ATP-binding cassette G37, pleiotropic drug resistance 9 (.1) Potri.008G099000 [exp] 66 / 1e-14 AT3G53480 1853 / 0.0 polar auxin transport inhibitor sensitive 1, ATP-binding cassette G37, pleiotropic drug resistance 9 (.1) Potri.018G032900 [exp] 65 / 4e-14 AT1G15520 2041 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.001G189500 [exp] 64 / 8e-14 AT1G59870 2113 / 0.0 PENETRATION 3, ARABIDOPSIS PLEIOTROPIC DRUG RESISTANCE 8, Arabidopsis thaliana ATP-binding cassette G36, ATP-binding cassette G36, ABC-2 and Plant PDR ABC-type transporter family protein (.1) Potri.001G048900 [exp] 64 / 1e-13 AT1G15520 2055 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.015G006000 [exp] 63 / 1e-13 AT3G53480 1921 / 0.0 polar auxin transport inhibitor sensitive 1, ATP-binding cassette G37, pleiotropic drug resistance 9 (.1) Potri.006G115000 [exp] 63 / 2e-13 AT1G66950 2148 / 0.0 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) Potri.008G098850 [exp] 63 / 2e-13 AT3G53480 1825 / 0.0 polar auxin transport inhibitor sensitive 1, ATP-binding cassette G37, pleiotropic drug resistance 9 (.1) Potri.010G153800 [exp] 62 / 3e-13 AT3G53480 1881 / 0.0 polar auxin transport inhibitor sensitive 1, ATP-binding cassette G37, pleiotropic drug resistance 9 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025824 [exp] 68 / 4e-15 AT1G59870 2220 / 0.0 PENETRATION 3, ARABIDOPSIS PLEIOTROPIC DRUG RESISTANCE 8, Arabidopsis thaliana ATP-binding cassette G36, ATP-binding cassette G36, ABC-2 and Plant PDR ABC-type transporter family protein (.1) Lus10014150 [exp] 65 / 5e-14 AT3G16340 2221 / 0.0 ATP-binding cassette G29, pleiotropic drug resistance 1 (.1.2) Lus10037562 [exp] 64 / 6e-14 AT1G59870 2178 / 0.0 PENETRATION 3, ARABIDOPSIS PLEIOTROPIC DRUG RESISTANCE 8, Arabidopsis thaliana ATP-binding cassette G36, ATP-binding cassette G36, ABC-2 and Plant PDR ABC-type transporter family protein (.1) Lus10027725 [exp] 60 / 2e-12 AT1G66950 1077 / 0.0 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) Lus10006277 [exp] 60 / 2e-12 AT1G66950 1791 / 0.0 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) Lus10008984 [exp] 59 / 4e-12 AT2G36380 2007 / 0.0 ATP-binding cassette G34, pleiotropic drug resistance 6 (.1) Lus10013123 [exp] 59 / 9e-12 AT3G16340 947 / 0.0 ATP-binding cassette G29, pleiotropic drug resistance 1 (.1.2) Lus10023878 [exp] 58 / 9e-12 AT2G36390 1253 / 0.0 BRANCHING ENZYME 3, starch branching enzyme 2.1 (.1) Lus10041668 [exp] 58 / 1e-11 AT1G15520 2128 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10008090 [exp] 58 / 1e-11 AT1G15520 2045 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.008G099201.1 pacid=42808685 polypeptide=Potri.008G099201.1.p locus=Potri.008G099201 ID=Potri.008G099201.1.v4.1 annot-version=v4.1 ATGCTCCGTCACCATTCATGTTCGCCAAAGGTCAATGATAACTATAATCCTGCAACGTGGATGTTGGAGGTTAATTCTGCATCAATGGAATCAGAACTTG GATTAGATTTCGCAGAACTTCACAAGGAGTCTCTCTGTACCTGGAGACATCTGAGTGGACCTCCACCACGTTCAAGAGACCAGCAGTTTTCCACAGAGTA G
AA sequence Show only first row Show all	>Potri.008G099201.1 pacid=42808685 polypeptide=Potri.008G099201.1.p locus=Potri.008G099201 ID=Potri.008G099201.1.v4.1 annot-version=v4.1 MLRHHSCSPKVNDNYNPATWMLEVNSASMESELGLDFAELHKESLCTWRHLSGPPPRSRDQQFSTE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G66950		ABCG39, PDR11, ...	ATP-binding cassette G39, plei...		Potri.008G099201 [exp]	0	1
					Potri.002G111832 [exp]	4.69	0.9511
					Potri.012G124633 [exp]	5.74	0.8105
					Potri.001G020250 [exp]	9.48	0.9283
					Potri.012G119350 [exp]	10.39	0.9283
AT2G34790		MEE23, EDA28	MATERNAL EFFECT EMBRYO ARREST ...		Potri.011G166601 [exp]	11.22	0.8792
AT2G32440		ATKAO2, CYP88A4...	ARABIDOPSIS ENT-KAURENOIC ACID...		Potri.001G144933 [exp]	13.41	0.9138
					Potri.008G139250 [exp]	14.42	0.8928
					Potri.002G047750 [exp]	16.24	0.8930
AT5G12260			unknown protein		Potri.012G123450 [exp]	17.54	0.8904
AT2G33480	NAC	ANAC041	NAC domain containing protein ...		Potri.015G007000 [exp]	19.07	0.8371

Compare expression of checked genes

Potri.008G099201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.